PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25171.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family CO-like
Protein Properties Length: 448aa    MW: 50173.2 Da    PI: 5.5118
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25171.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.84.5e-08649340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                             +r C+ +  k++++fC  ++ +lC+ C  + H+       H++v
  mrna25171.1-v1.0-hybrid  6 ARACDSCLVKRARWFCGADDAFLCQRCDASVHSAnllasrHERV 49
                             678*****************************668888888776 PP

2CCT68.12.4e-23376419144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  mrna25171.1-v1.0-hybrid 376 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 419
                              9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.0E-9451IPR000315B-box-type zinc finger
PROSITE profilePS5011910.21451IPR000315B-box-type zinc finger
PfamPF006439.8E-7649IPR000315B-box-type zinc finger
CDDcd000217.36E-8751No hitNo description
PfamPF062036.1E-18376418IPR010402CCT domain
PROSITE profilePS5101716.083376418IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGGNTARACD SCLVKRARWF CGADDAFLCQ RCDASVHSAN LLASRHERVR LKSSSHKVSD  60
HLAIEPPVPA WQQGVTRKAR TPRGHGNHKS GKDEAGKALG QSMPFVPEIG SEEVDYCCLE  120
DDHESEDLEQ LLYRVPIFDP FEGELCNNMT NIDHHKVKMG HEDYGARTSS TSPCDELDNF  180
QGLILPSDME LAEFAADVEN MLGKGLDEDC SDIKGLGLLD ETKEEEDYGM DVCIGIEERK  240
LVKIEEEDQG MECEFNPSML DWNLDYDDES AAVLLGGSTS TDQEEEDKVA VLMEAEKKRK  300
KICLRLNHEA VISAWASKGS PWTTGVKPEL NPDDGWPDCM GVWGTNQIMN LQGHGDSSAA  360
AHRMGMRGDT EQRPGREARV SRYREKRRTR LFSKKIRYEV RKLNAEKRPR MKGRFVKRTS  420
FQTGMGTSST TTASNAPHYQ QQQHLKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296300KKRKK
2386402RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna25171.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300528.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
TrEMBLA0A2P6P3N70.0A0A2P6P3N7_ROSCH; Putative transcription factor C2C2-CO-like family
STRINGXP_004300528.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-84B-box type zinc finger protein with CCT domain