PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna25098.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 224aa MW: 25348.5 Da PI: 8.236 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.1 | 3.6e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ed ll+++++ +G g+Wk+++++ g+ R++k+c++rw +yl mrna25098.1-v1.0-hybrid 14 RGPWTRREDTLLIQYIQSHGEGHWKSVPKKAGLLRCGKSCRLRWINYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 50.5 | 4.8e-16 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T++E++l+++++ +lG++ W++Ia +++ gRt++++k++w++ mrna25098.1-v1.0-hybrid 67 RGNITPDEEDLIARLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110 7999******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.3E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.986 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.75E-29 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.20E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 23.901 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-14 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.37E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MGRTPCCSKE GLQRGPWTRR EDTLLIQYIQ SHGEGHWKSV PKKAGLLRCG KSCRLRWINY 60 LRPDIKRGNI TPDEEDLIAR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT KLSKRLKNSG 120 STTKGASKPL NKDDQGSEAK VKVHQPKAFR VSANSMLAQL GHHDAEVSND LHDHNHFGDA 180 LVCENVKGFD DFDMYEEFQQ LLHKADQDYD GPDLDSFVDS LLI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
UniProt | Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269|PubMed:24319076, ECO:0000269|PubMed:25053018}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna25098.1-v1.0-hybrid |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269|PubMed:24319076, ECO:0000269|PubMed:25053018}. | |||||
UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004301814.1 | 1e-167 | PREDICTED: transcription repressor MYB5-like | ||||
Swissprot | Q38850 | 9e-61 | MYB5_ARATH; Transcription repressor MYB5 | ||||
Swissprot | Q42379 | 1e-60 | MYB7_ARATH; Transcription factor MYB7 | ||||
Swissprot | Q9FJ07 | 5e-60 | MY111_ARATH; Transcription factor MYB111 | ||||
TrEMBL | A0A2P6P3Z3 | 1e-128 | A0A2P6P3Z3_ROSCH; Putative transcription factor MYB-HB-like family | ||||
STRING | XP_004301814.1 | 1e-166 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 4e-63 | myb domain protein 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna25098.1-v1.0-hybrid |