PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23905.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family CO-like
Protein Properties Length: 424aa    MW: 46343.7 Da    PI: 5.1715
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23905.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.32.3e-062765538
                 zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                              C+++++++++  C d ++ lC++C  + H++      H+
  mrna23905.1-v1.0-hybrid 27 LCEKCNDQPATVRCLDVNVSLCQSCEWS-HNNgvtgmaHR 65
                             6************************888.97767666665 PP

2CCT639.4e-22367410144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              R++a++RY eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  mrna23905.1-v1.0-hybrid 367 RDKAKMRYEEKKKTRTFGKQIRYASRKARADTRKRVKGRFVKSG 410
                              899**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.6172369IPR000315B-box-type zinc finger
PfamPF062031.5E-16367409IPR010402CCT domain
PROSITE profilePS5101714.793367409IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MARLCLNCDG CVHSANALAR RHARWFLCEK CNDQPATVRC LDVNVSLCQS CEWSHNNGVT  60
GMAHRNQAIS FYTGCPSLSE ISRIWSAVLE GGSASGGFGG SGWESLGGTM VSKNEKNCIS  120
SCRDSEASSF GVVSAGNKFN EVLAESNCTP DFEPWMATST VIPSNPNCIQ PQCKDQTPLP  180
FLPQESSQLP KGSSNLKDLG IQDGNDLCEG LNMDDVPLDV ENDDELFSCS QGPSRYPFED  240
GEFDCLLMDQ KNLSVTESNG PHCDNAIQQA SPSRQQDCTL GFQSSCDSVM PPVMNAGLLM  300
NPSCSRNINL EGLLNPTGQV HSSISLSLSS ITRDTTHPDY QDCGLSPVFL SAEPWDSTLE  360
AGSPRARDKA KMRYEEKKKT RTFGKQIRYA SRKARADTRK RVKGRFVKSG EEYDYDPLTR  420
RSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna23905.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463098.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11 isoform X2
TrEMBLA0A2P6S2F30.0A0A2P6S2F3_ROSCH; Putative transcription factor C2C2-CO-like family
STRINGXP_004289156.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70521923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.14e-76B-box type zinc finger protein with CCT domain