PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23279.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 345aa    MW: 37442.1 Da    PI: 5.6719
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23279.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.22e-17252285134
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                              C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  mrna23279.1-v1.0-hybrid 252 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 285
                              99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.6E-681338IPR016679Transcription factor, GATA, plant
SMARTSM004017.6E-17246296IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.319246282IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-14250283IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577166.65E-15250309No hitNo description
CDDcd002024.36E-14251298No hitNo description
PfamPF003204.3E-15252285IPR000679Zinc finger, GATA-type
PROSITE patternPS003440252277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MITPSFVDEI DCGSFFDNID DLMEDVDSVL GPAPDCNSAF SLWPAASSAA AAPLPPPDAA  60
VFSGNGDSDF SSELPVPYEE MVHLEWLSNF VENSEYSGGD LTMNKQQESY SLVNKESSHQ  120
QFQTSSPISV LDSSSSCSGE KNVLEGSIAP GRRGRARSKR PRPATFNPRS AIQLISPASS  180
VSEIDNPLQQ HSLFAAPKVF SESENFAESR PVVKMPKLAS GEQKKKKRIK LPPQVPGELD  240
ENSPLQGAIR KCLHCEITKT PQWRAGPMGP KTLCNACGVR YKSGRLFPEY RPAASPTFVP  300
ALHSNSHKKV LEMRTKGGEM VSVHDNSLPE LIPNTNSSIS LDYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158162KRPRP
2223230KKKKRIKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna23279.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU8158319e-87GU815831.1 Fragaria x ananassa clone ChFaM091 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307386.10.0PREDICTED: GATA transcription factor 8
TrEMBLA0A2P6SJF00.0A0A2P6SJF0_ROSCH; GATA transcription factor
STRINGXP_004307386.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.25e-44GATA family protein