PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna22839.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-PHD
Protein Properties Length: 1238aa    MW: 134794 Da    PI: 4.6224
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna22839.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.21.2e-1210731116952
                               HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
                 Homeobox    9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52  
                               +  +++L + F++n+yp+++++e+LA++lg+  +qV+ WF N R
  mrna22839.1-v1.0-hybrid 1073 EAVTQRLYTSFKENQYPDRSMKERLAQELGVMAKQVSKWFENAR 1116
                               567899************************************99 PP

2PHD37.94.1e-13697752151
                              SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                      PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                              +C+ Cg+    ++++++lCdg C++ fH+ Cl+++l see+p +   wlC+ C++k
  mrna22839.1-v1.0-hybrid 697 FCAKCGSldVYADNDIILCDGaCDRGFHQHCLEPPLLSEEIPPDdeGWLCPGCDCK 752
                              699****75556********66*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.44E-13687755IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.2E-12693752IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.003695752IPR019787Zinc finger, PHD-finger
SMARTSM002493.1E-9697750IPR001965Zinc finger, PHD-type
CDDcd155041.35E-26697749No hitNo description
PfamPF006281.7E-10697752IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590698749IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.608.0E-1310521116IPR009057Homeodomain-like
PROSITE profilePS5007112.13110621122IPR001356Homeobox domain
SuperFamilySSF466891.37E-1010641120IPR009057Homeodomain-like
SMARTSM003896.9E-810651126IPR001356Homeobox domain
CDDcd000861.21E-1010691116No hitNo description
PfamPF000463.0E-1010731116IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1238 aa     Download sequence    Send to blast
MADDAQLDIP PDCVSSQTAK CQEESTSGHA HEVGPESGYG ESSKQKVGCD VLPNELKEFC  60
NFSNNDDNQS QAFGDVTEKS HPEQLGLPPE DASNSSQGGV NLLANSAHGH QFGSVHIQNG  120
LLQTTTALSG YTTSGHLQPF FGNVTKNSLA EPVELPPEES LEDLGLNCQT GKTACSERIS  180
LEQRNDFGFG TSSCETREEK QHIGSDSVQN ELLQTSIPVS SCGSEQLQLI TERVNVTFPN  240
EQARVPPKDV SKTLEPTNNF GFGTSSSVLA EDKQHCGSDV PQNEALQSQY WTRTIRLEVP  300
SCDGNEPLLS FCENVDICSL DEKAGLPCEG LKKTLKQIND VSSGTSYSQP TEENQNLGSS  360
FVQDEPLQTI IPVVSSGGNE QLRVVNENVS VPSLGEQAGL LPEAVSKTCQ TDKLSRSLHT  420
ASDQINESGS GSVQCEPQEQ RDQLGSLPSQ NDQVKNSTAV SSSIGFEQSG PSVDEMNNSV  480
IGHLEPPPED ASKDHNKELI KPHTNDATQN SCLEPSETAS KNASKNSTQF GCKDKRNSSS  540
RRKSRSLVSS DRVLRSRTSE KPEAPELSNN VATLDTSNSV ANVSNEKEGK RKKRKKKHRE  600
RVAADEFSRI RSHLRYFLNR INYEKSLIDA YSSEGWKGNS LEKLKPEKEL QRATSEILRR  660
KSKIRDLFQR LDSLCAEGMF PESLFDEEGQ IDSEDIFCAK CGSLDVYADN DIILCDGACD  720
RGFHQHCLEP PLLSEEIPPD DEGWLCPGCD CKVDCIDLLN DSQGTDLSIT DSWEKVFPEA  780
AVAASAGQHQ ENNQGLPSED SDDDDYDPDG PETDEEVQEG ESSSDESEYA SASDGLETPK  840
TNDEQYLGIP SDDSEDDDFN PDAPDPTEDV KQGSSSSDFT SDSEDLAAVL DEDRKSFENG  900
EGPQSSVLEA STLLRGSGGK GSKRGQKRHF IKDELSSLIE SDPGQDGSTP VSGKRHVERL  960
DYKKLHDEEY GDIPTSDDEE YIETAVPRKR KKGAGQVSPG SLKGKPSTIK KGKTTKDIKD  1020
DPDKNEHTPR RTPRRKSSAN DNSSSPNESL KSSPKSGSTS GRAKGSTYRR LGEAVTQRLY  1080
TSFKENQYPD RSMKERLAQE LGVMAKQVSK WFENARHCVK AGLALPQAMR TQPNQAETSI  1140
KDAHHDGAQK NESPGTADAV AGSCSQDVKD NKLATPKSSR AKTSAPKGRK RKSKSDPGGS  1200
DLDEKFKTPP ETSSRGKSTF KQTVPLDALE TALCLYN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1590596RKKRKKK
2987991RKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna22839.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289744.10.0PREDICTED: homeobox protein HAT3.1 isoform X1
RefseqXP_011457794.10.0PREDICTED: homeobox protein HAT3.1 isoform X1
TrEMBLA0A2P6PLL00.0A0A2P6PLL0_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004289744.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84373141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-84Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain