PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21453.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 160aa    MW: 17553.6 Da    PI: 8.2335
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21453.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP85.99.9e-2717101488
                      TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                              +k ++ +  Tkv+g + R Rl+ +caa +F+ ++eLG+++d++tieWLl+qa+p+i   tg+s ++++ +++  s+++++ +  +
  mrna21453.1-v1.0-hybrid  17 GKASSEDNNTKVDGHGHRTRLPPTCAAWIFQFTRELGHKTDGQTIEWLLKQAEPSILVVTGNSVTPSNTSSTLVSVNMQAGNVVS 101
                              789999********************************************************99999777444444444322222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-2020106IPR005333Transcription factor, TCP
PROSITE profilePS5136916.8512175IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MGTNPWNASR SRNKVLGKAS SEDNNTKVDG HGHRTRLPPT CAAWIFQFTR ELGHKTDGQT  60
IEWLLKQAEP SILVVTGNSV TPSNTSSTLV SVNMQAGNVV SEDKNSLRKK CTKGGGQPMP  120
PPYDHYLKII TKNYSIEFSV NDVAIDVGIE AQREDERQD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna21453.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011459878.11e-117PREDICTED: transcription factor TCP8-like
TrEMBLW1PHC61e-25W1PHC6_AMBTC; Uncharacterized protein
STRINGERN093972e-26(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.15e-28TCP family protein