PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna20756.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 228aa    MW: 24909.1 Da    PI: 8.6946
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna20756.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA565.5e-18149182134
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                              C +Cgt +Tp+WR gp g+ktLCnaCG++y++ +
  mrna20756.1-v1.0-hybrid 149 CLHCGTDQTPQWRAGPHGPKTLCNACGVRYKSGR 182
                              99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-14143193IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.36143179IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.23E-15145206No hitNo description
Gene3DG3DSA:3.30.50.103.4E-15145180IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.68E-16148199No hitNo description
PROSITE patternPS003440149174IPR000679Zinc finger, GATA-type
PfamPF003203.4E-16149183IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MVPLDPAACL VDDLRNFLSD VADHDARPDD PSRPLVPTEE AEEELEWISN KDAFPAVETF  60
ILSEQVGGIA IAKHQSPVSV LETSTNSSSA SLMSSCGGLK PPHRARTKGR RRRSEIPPQQ  120
LFWNQPPIES SKPSRSSGSA SKLDIGRKCL HCGTDQTPQW RAGPHGPKTL CNACGVRYKS  180
GRLCPEYRPA SSPSFSSQMH SNSHRKVLEM RKHKYGVGMV VKPEDKG*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna20756.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309758.11e-168PREDICTED: GATA transcription factor 1
SwissprotQ8LAU91e-46GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A2P6QRV01e-122A0A2P6QRV0_ROSCH; Putative transcription factor C2C2-GATA family
STRINGXP_004309758.11e-168(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85372941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.13e-37GATA transcription factor 1