PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna20752.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 656aa    MW: 72087.7 Da    PI: 8.1637
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna20752.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA31.52.4e-10382409128
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGl 28 
                              C++Cg  ++p W   p g+ktLC aCGl
  mrna20752.1-v1.0-hybrid 382 CHHCGDEQSPRWLGVPLGPKTLCHACGL 409
                              ***************************9 PP

2GATA53.43.4e-17614645132
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                              C+nCg+ +TplWR+gp g+ktLCnaCGl++ k
  mrna20752.1-v1.0-hybrid 614 CHNCGAEETPLWRSGPMGSKTLCNACGLRWYK 645
                              ******************************66 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004010.0026376421IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.19E-6376411No hitNo description
Gene3DG3DSA:3.30.50.105.2E-6381410IPR013088Zinc finger, NHR/GATA-type
PfamPF003205.2E-8382410IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.3E-5510543IPR013088Zinc finger, NHR/GATA-type
SMARTSM004010.032554603IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-12607649No hitNo description
SMARTSM004011.6E-12608654IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.666608641IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-15612645IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.18E-11613647No hitNo description
PROSITE patternPS003440614639IPR000679Zinc finger, GATA-type
PfamPF003201.5E-14614645IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MKSTKDSFSA VETLNILDNS RGNFLAEHQS PVLVVKNSTN SSAALMSSSE SVEQQQLVYN  60
PANNKLNKND TSKVEIEGKN TTSMSSYGTL ALPHQVPSKF LGPQPLFFDQ PNNNCNKKDT  120
DIVGIVVKCQ NCGDEFSPQQ WEGALGPQTL CLSCMVAKCT PRKKRSTSLA SNKKRKKEDI  180
AKVEMAVKPG DKCTNSTVVL MNSKKDPFID TLNISEQPVF IAIAEQQTPA SVFESSTNSS  240
MTLVSSSGTV KPLNQAPSVF LGQQNQFCDS ANYEPKEKDV PTMEIEGNSS TLMRSRPNLA  300
LNELMEQQQL FCNQSNNKAN KKDAVRVESE GNSTTLMSPC ETSKPLHQAQ SEFLGQEQLF  360
CNQANNETNK ENTAKVESEG KCHHCGDEQS PRWLGVPLGP KTLCHACGLA KCAAQQQKSI  420
AVEVGETPCI FPTGKITNST FTLPVLDEFY FLQKPSYIAN AQPQNLSSGL ETSKNNSIDL  480
MSSCRIKFPH RARSKGLCRR RSTIPGQQVQ IGANCMQCGK QTNRWRMGPL GPTTLCNVCG  540
NKYQPLWGIS SVIVNIAQVC QHCESEEATE WLMCPVGPKA LCAACYHWIK YFCNQTNNNP  600
DRKASTEVDN GRKCHNCGAE ETPLWRSGPM GSKTLCNACG LRWYKFGDLC RQPSK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162176KKRSTSLASNKKRKK
2172176KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna20752.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011471045.10.0PREDICTED: GATA zinc finger domain-containing protein 5-like isoform X1
TrEMBLA0A2P6QRU40.0A0A2P6QRU4_ROSCH; Putative transcription factor C2C2-GATA family
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3422722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-12GATA transcription factor 1