PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna17249.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-PHD
Protein Properties Length: 705aa    MW: 79119.2 Da    PI: 9.6781
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna17249.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.91.1e-10477521953
                              HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                 Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                              ++ +e L ++F++n  ps++ +  L+k+lgL+ ++V+ WF+N R+
  mrna17249.1-v1.0-hybrid 477 RNAVEKLRQVFYENELPSKAVKDNLSKELGLDPEKVSKWFKNTRY 521
                              578899*************************************97 PP

2PHD39.81e-13236291151
                              SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                      PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                              +C+ C+ +++  ++++vlCd +C+ +fH+kCl+++l++e++p+g   w+C+ C++k
  mrna17249.1-v1.0-hybrid 236 FCAKCKLNEAfpDNDIVLCDgTCNAAFHQKCLDPPLDTENIPRGdqGWFCKFCECK 291
                              699999955455********56*********************999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.26E-14227294IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.2E-12232291IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.264234291IPR019787Zinc finger, PHD-finger
PfamPF006286.2E-11236291IPR019787Zinc finger, PHD-finger
SMARTSM002494.9E-9236289IPR001965Zinc finger, PHD-type
CDDcd155042.17E-30236288No hitNo description
PROSITE patternPS013590237288IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.602.1E-12458520IPR009057Homeodomain-like
PROSITE profilePS5007112.487466526IPR001356Homeobox domain
SMARTSM003891.2E-9468530IPR001356Homeobox domain
SuperFamilySSF466894.28E-10469530IPR009057Homeodomain-like
CDDcd000863.43E-8474521No hitNo description
PfamPF000463.7E-8477521IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MHGLGKKSSV QESGKSRYST PLSKLLSSPK FKKSGKVSHV KKVKPKSKTT IASSLLKRRN  60
ADSSRKGTKN NDTSKKLTSR KGLHKARDAD NSNKSSSLKL QKDKVSKDGS DEKADEKGEN  120
VDGETRIRKR RRKKKSKKNK VDVDETARLQ RRTRYLLIKI KLEQNLIDAY SGEGWKGQSR  180
EKIKPERELQ RAENQILKCK LGIRDAIYQL HSLGSVGSIA DSVIDPDGSV FHEHIFCAKC  240
KLNEAFPDND IVLCDGTCNA AFHQKCLDPP LDTENIPRGD QGWFCKFCEC KMEILEVVNA  300
HLGTCFSMDS TWQDVFKEEA AFPDGGNLLL NPDEEWPSDE SDDDDYNPDR NVNSCSVSRE  360
GSDDNASDDE LSTDGSVGSD ESTDGDIVSG RRQRSSVDYK KLYDEMFGKD GLVLEQVSDD  420
EDWGPGKRKR REKESDAAST LMTLYESERN PGSVPTEVKS KPTTDTQARR SCFRIPRNAV  480
EKLRQVFYEN ELPSKAVKDN LSKELGLDPE KVSKWFKNTR YLALKTRKAE GTKDLPTSAS  540
EINKESRYEN VTGKAPDLME SDSEDISAET VVHSPRNIKK SFRRKHPKSL SSPLKKNQQK  600
GSSWLSPAKS NKEDGMELSD DVSLKKLLKG KTKEKRAKII AGSGGESQVA ELEMERLCKV  660
KSRLENMRQI LLKFQTAKAK KSKKPPLHEQ TVIYVPVAEL KEKV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127131RKRRR
2127134RKRRRKKK
3128134KRRRKKK
4129137RRRKKKSKK
5427432RKRREK
Functional Description ? help Back to Top
Source Description
UniProtSpecifically binds to the fungal elicitor-responsive DNA element, 5'-CTAATTGTTTA-3', of the gene PR2 promoter.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna17249.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By pathogen infection.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011462372.10.0PREDICTED: pathogenesis-related homeodomain protein
SwissprotP487851e-155PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A2P6QSL60.0A0A2P6QSL6_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_008223879.10.0(Prunus mume)
STRINGEMJ257220.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52753349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-154pathogenesis related homeodomain protein A
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]