PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15156.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 343aa    MW: 37104.3 Da    PI: 7.5357
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15156.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.71e-31104161260
              ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                              ++vrY+eClkNhAa++Gg+++DGCgEfmp  geegt +alkCaAC+CHRnFHR+ev+ e
  mrna15156.1-v1.0-hybrid 104 SNVRYRECLKNHAANIGGNVFDGCGEFMPC-GEEGTLEALKCAACDCHRNFHRKEVDGE 161
                              689**************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-23101159IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-28105158IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.9E-29107158IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.417108157IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.85E-19239305IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30241304IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-28243300IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MRTSGSAALS YGGTHLTKES SGGGEKRRLG NIHNGTPAGL SAFTANHQTL DHHHHPLQPH  60
HAQVVQPVPL PTRDPDPDRV IASNALVPSS AVARSKTPTL ATASNVRYRE CLKNHAANIG  120
GNVFDGCGEF MPCGEEGTLE ALKCAACDCH RNFHRKEVDG ETMTPFGHGS RSRSIMLSPI  180
QLPPPLPSPH HRHQKFSIVQ PMSVAFGGSG GGGGGESSSE DLNVFDNADG IGGGVAPPYS  240
LSKKRFRTKF TAEQKVRMVE FAEKVGWRIQ KQDEEDVERF CDEVGVKRQV LRVWMHNNKN  300
TVKKMQHDHD HDITTTTSQL ALENNVEAHE QQPGGQGGTT DT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-242443011875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21779177}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna15156.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269|PubMed:21779177}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293203.20.0PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9FRL54e-65ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A2P6PYR51e-160A0A2P6PYR5_ROSCH; Putative transcription factor ZF-HD family
STRINGXP_004293203.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.13e-62homeobox protein 33