PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14981.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family CO-like
Protein Properties Length: 313aa    MW: 34506.7 Da    PI: 6.7558
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14981.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box284.4e-09746437
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                             + C+ +++  ++lfC+ ++ +lC +C +++H        H
  mrna14981.1-v1.0-hybrid  7 KLCDSCKSATATLFCRADSAFLCINCDTKIHAAnklasrH 46
                             68*****************************554455555 PP

2zf-B_box28.92.3e-094994342
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                              + C+ +e+ +++  C+ ++  lC +C  e+H+       H++vp+
  mrna14981.1-v1.0-hybrid 49 VWLCEVCEQAPAHVTCKADDATLCVTCDREIHSAnplsrrHERVPV 94
                             679*****************************66899999*99986 PP

3CCT70.15.8e-24251294144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  mrna14981.1-v1.0-hybrid 251 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 294
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.9E-14451IPR000315B-box-type zinc finger
PROSITE profilePS5011910.808451IPR000315B-box-type zinc finger
PfamPF006431.0E-6746IPR000315B-box-type zinc finger
CDDcd000211.49E-9851No hitNo description
PROSITE profilePS5011910.8364794IPR000315B-box-type zinc finger
PfamPF006431.6E-74994IPR000315B-box-type zinc finger
CDDcd000215.25E-95094No hitNo description
SMARTSM003363.6E-105294IPR000315B-box-type zinc finger
PfamPF062034.4E-18251293IPR010402CCT domain
PROSITE profilePS5101716.787251293IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MASMASKLCD SCKSATATLF CRADSAFLCI NCDTKIHAAN KLASRHARVW LCEVCEQAPA  60
HVTCKADDAT LCVTCDREIH SANPLSRRHE RVPVAPFYDS LNSGKSDAAA VNLLDDRYLS  120
DGETTEAEAA SWLLPNPKDL NSGQYVFSDM DSYLDLDYGT PADPKTEAQE QNSSATDGVV  180
PVQSKSAQPQ SFEMELPGSK PFIYLSQSVS SSPLDVSIVP DGNMSDPYPK SISSAVDQLS  240
HPTVQISSAD REARVLRYRE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF AKRTEVEIEA  300
ERLCRYGVVP SF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna14981.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9393036e-63EU939303.1 Prunus persica CONSTANS-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291989.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-123COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2P6PY470.0A0A2P6PY47_ROSCH; Putative transcription factor C2C2-CO-like family
STRINGXP_004291989.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-122CONSTANS-like 4