PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14755.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 359aa    MW: 39709.2 Da    PI: 9.058
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14755.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.84.8e-32137194260
              ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                              ++vrY+eClkNhAa++Ggh++DGCgEfmps gee ++ +lkCaAC+CHRnFHR+e e e
  mrna14755.1-v1.0-hybrid 137 KAVRYRECLKNHAATTGGHVLDGCGEFMPS-GEEDSPGGLKCAACDCHRNFHRKEIEGE 194
                              579**************************9.8888********************9875 PP

2Homeobox16.31.6e-05295355157
                              TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                              +r Rt+f++eq + + e+ e    + ++ +++e ++L ++lg++ ++ kvW +N ++ +kk
  mrna14755.1-v1.0-hybrid 295 KRFRTKFSQEQKDKMMEVAEklgwRIQKHDEHEVQQLCSELGVKRQVFKVWMHNNKQAMKK 355
                              789************99999676668999****************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-21138195IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.0E-29139191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.1E-29140191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.995141190IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.84E-19283355IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-29285356IPR009057Homeodomain-like
PROSITE profilePS500719.264292356IPR001356Homeobox domain
TIGRFAMsTIGR015651.6E-26294351IPR006455Homeodomain, ZF-HD class
CDDcd000860.00151295357No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEIRAGQDKI LGMPTTLGFN PQNRESSSSS RLSSPSLHHH HHVNNTLIFN HPQTLDPFYQ  60
PQTQHHHHHH QPQQSNPYKP RDPDPVPNPD PNLSPAAVCT TPRATSSTPR GANHSFKAAP  120
SAAQAQVPVP EPVPASKAVR YRECLKNHAA TTGGHVLDGC GEFMPSGEED SPGGLKCAAC  180
DCHRNFHRKE IEGETQLVHV PNNYHVLNHP NKNSHSSRRN ASSAPVVPSL PAPPPVHHHH  240
QYHHFPATSP NVAGSFPPGS MMTFGGGGGA AESSSEDLNH MNMYDQSNQA GSSRKRFRTK  300
FSQEQKDKMM EVAEKLGWRI QKHDEHEVQQ LCSELGVKRQ VFKVWMHNNK QAMKKKQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-232933521675ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna14755.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3843463e-34FQ384346.1 Vitis vinifera clone SS0AAG1YN20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287891.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW73e-60ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A2P6RMD61e-169A0A2P6RMD6_ROSCH; Putative transcription factor ZF-HD family
STRINGXP_004287891.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-26homeobox protein 22