PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13351.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 328aa    MW: 34335.7 Da    PI: 7.1666
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13351.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.91e-3551121373
                      TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                              +++++++++hTkv+gR+RRvR++a caar+F+L++eLG+++d++ti WLl+ a+pai+++tgt++ +a ++
  mrna13351.1-v1.0-hybrid  51 KQRSSTKDRHTKVEGRGRRVRMPAACAARVFQLTRELGHKTDGETIRWLLEHAEPAIIAATGTGTVPAIAV 121
                              57899**********************************************************88888444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.2E-3055133IPR005333Transcription factor, TCP
PROSITE profilePS5136927.15656110IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEENQRQSLE PMNPTFSGHQ FPAAAKKEEF EEGSLSMGLI PVPASAKPVV KQRSSTKDRH  60
TKVEGRGRRV RMPAACAARV FQLTRELGHK TDGETIRWLL EHAEPAIIAA TGTGTVPAIA  120
VSVGGALKIP TSSLANPNGE VSELPRKKRR LHCNSEFVDV EDLSSISSGL APMATVNYGG  180
IGGGGGGGLV PMWQFGANVP AVPFLMFPNS GWAIPSDSVS GQTMFNLQGR PMSNFPVTAL  240
QSGVEVHSCG DVQATSGSIL SGGGSCSTSL GVSNSNAVTS SDTSATTAAP MSHTQLLRDL  300
SLDTLDKREL QFLGDLCGNS QAQYSRP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144150PRKKRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBMTransfer from AT5G51910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13351.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309238.20.0PREDICTED: transcription factor TCP19
SwissprotQ9LT892e-65TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A2P6SMS71e-178A0A2P6SMS7_ROSCH; Putative transcription factor TCP family
STRINGXP_004309238.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.27e-64TCP family protein