PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12294.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 285aa    MW: 29893.1 Da    PI: 9.8083
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12294.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.52.3e-3848141296
                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                              a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s  +++s++
  mrna12294.1-v1.0-hybrid  48 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-TVSVSLRGGASTA 132
                              78**************************************************************99999766.3444444443333 PP

                      TCP  88 gkaaksaak 96 
                              ++ ++s+++
  mrna12294.1-v1.0-hybrid 133 TSLSNSSTT 141
                              322222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.20954108IPR017887Transcription factor TCP subgroup
PfamPF036342.3E-3354143IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSNSEAPNNE QLSNGAAAAA MMMERQQQQQ QTQQQQTAQQ PSSNGVLAVK KPPSKDRHSK  60
VDGRGRRIRM PIICAARVFQ LTRELGHKSD GQTIEWLLRQ AEPSIIAATG TGTTPASFST  120
VSVSLRGGAS TATSLSNSST TTSSDHKPLL GGGGPTPFIL GKRMRTDDDG KDSDNHHGGN  180
DGGGAVSVVG HHSMSSMLGP AAAAQGGFWA PHFGQVWSFA ATPPPELMSQ QQSVSQQHSL  240
FLQQQPMGEA SAARVGNYLP GHLNLLASLS GGHGNSGRRE DDPR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna12294.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2407982e-75AK240798.1 Oryza sativa Japonica Group cDNA, clone: J065002G04, full insert sequence.
GenBankAP0047762e-75AP004776.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0452F04.
GenBankAP0149582e-75AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126102e-75CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301414.10.0PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX22e-89TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A2P6QSB41e-141A0A2P6QSB4_ROSCH; Putative transcription factor TCP family
STRINGXP_004301414.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-65TCP family protein