PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09326.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 211aa    MW: 22799.3 Da    PI: 8.5005
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09326.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.43.9e-29960457
              ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                              +Y+eCl+NhAaslG++a+DGCgEf+ +  +++++ +l+CaACgCHRnFHRr +
  mrna09326.1-v1.0-hybrid  9 DVYRECLRNHAASLGSYATDGCGEFTLD--DTSSPGGLQCAACGCHRNFHRRVT 60
                             58*************************8..5578******************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.1E-241060IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-171158IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.8851159IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.3E-231158IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.93E-15123190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-27124191IPR009057Homeodomain-like
TIGRFAMsTIGR015654.3E-28133191IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MEGENSSNDV YRECLRNHAA SLGSYATDGC GEFTLDDTSS PGGLQCAACG CHRNFHRRVT  60
YAPGVGRSSG VAGTAHHRVI SCSSRGGRGD LHHDMMTSQE LIDYNVGGGG GAAARQMMVV  120
ESPDSGDRSG SGRKRFRSKF TVEQKEKMLA FAEKLGWKLQ RKDLEDEIER FCRSIGVSRQ  180
VFKVWMHNHK NLSSSSSAST TANASSLTTQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-221341961879ZF-HD homeobox family protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna09326.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299496.11e-156PREDICTED: zinc-finger homeodomain protein 10-like
TrEMBLA0A2P6P1P41e-128A0A2P6P1P4_ROSCH; Putative transcription factor ZF-HD family
STRINGXP_004299496.11e-155(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79822844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-34homeobox protein 31