PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08990.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 382aa    MW: 41839.3 Da    PI: 6.7074
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08990.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17263297135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  mrna08990.1-v1.0-hybrid 263 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 297
                              99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.8E-7420352IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.308257293IPR000679Zinc finger, GATA-type
SMARTSM004019.7E-17257307IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-14258294IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.23E-15259321No hitNo description
CDDcd002021.13E-14262309No hitNo description
PfamPF003201.4E-15263297IPR000679Zinc finger, GATA-type
PROSITE patternPS003440263288IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEAPEYFQNS FCPQFVTEKR HSLDSTKANN NGAGAGDSFM VEDLLDFSND DAVITDVAAA  60
AVFDNVTGNS TDSSTLTVID SSSNSSSLSG CEPANFAVDL GGRSLHEVPF SSDLCVPYDD  120
LAELEWQLSS FSEESFSSED LQKLQLISGM KARPDEAASE TRHFQPDPNN NQSNSNHNNP  180
IFNSDISVPA KARSKRSRAA PGNWTSRLLL LSPTESSPES SDVVVSEQPL PPSSVGKKTL  240
KAAPKKKENP EGGAAAPGDG RKCLHCATDK TPQWRTGPMG PKTLCNACGV RYKSGRLVPE  300
YRPAASPTFV LTKHSNSHRK VLELRRQKEM VRAQQQYIHH QPPPHHHHHH HHHHNPNMIF  360
DVNGGDYLIH QHVGPDFRQL I*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna08990.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291171.20.0PREDICTED: GATA transcription factor 12
SwissprotP697811e-93GAT12_ARATH; GATA transcription factor 12
TrEMBLM5Y8040.0M5Y804_PRUPE; GATA transcription factor
STRINGXP_004291171.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-64GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]