PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08472.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SRS
Protein Properties Length: 378aa    MW: 41117.1 Da    PI: 8.3548
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08472.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702206.76.2e-641633023154
                   DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalss 88 
                              sg+++CqdCGnqakkdC h RCRtCCksrgf+C+thvkstWvpaakrrerq+q +a+++++ ++++ + +kr+re+ ++  s+l++
  mrna08472.1-v1.0-hybrid 163 SGGMNCQDCGNQAKKDCPHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQEQFSALQQQQ-QQQQLQFPKRQREN-QAGGSSLAC 246
                              7899************************************************999987766.55677788888886.778899999 PP

                   DUF702  89 tklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                               +l++++s           evss+avfrcvrvs++dd +e++aYqtav+igGhvfkG+Lyd+Gl++
  mrna08472.1-v1.0-hybrid 247 VRLPTNTSA----------EVSSPAVFRCVRVSAMDDVDEQYAYQTAVNIGGHVFKGLLYDHGLDN 302
                              999988754..........9*******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.3E-62165301IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.5E-26167209IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.0E-25255300IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MVRKRSRSCG FSGAITDTWT YSDRSGLINR KKEPERPCVY VTELELANLG GGRDQGVRNK  60
QGGDDERGGN LNLFSYGNEE IYNNSKGGFE LWPQYHPHHP HHHHHQQQSL NYYAFGVDPS  120
RRSNHNNLEG NVSDDSSSGL RLTVMRQGSG TGGGGGSGTG LGSGGMNCQD CGNQAKKDCP  180
HLRCRTCCKS RGFQCQTHVK STWVPAAKRR ERQEQFSALQ QQQQQQQLQF PKRQRENQAG  240
GSSLACVRLP TNTSAEVSSP AVFRCVRVSA MDDVDEQYAY QTAVNIGGHV FKGLLYDHGL  300
DNANYTSATT VGESSSGGQQ DGGGGHHNNQ QQLNLITAPT STSANPPTAT LLDPTMVFPT  360
PLNAFVAGTQ YFPPPRS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna08472.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011459133.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD402e-72SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A2P6PYY71e-151A0A2P6PYY7_ROSCH; Putative transcription factor STY-LRP1 family
STRINGXP_004291405.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-65SHI-related sequence 7
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]