PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna06857.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 170aa MW: 18967.2 Da PI: 5.5793 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 152.1 | 1.1e-47 | 30 | 120 | 6 | 96 |
NF-YB 6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 ++lPianv+r+mk++lP nakisk+ak+t+qecvsefisfvt+easdkc++e+rkt+ngdd++ al+tlGf+dy++ l+ yl++yr mrna06857.1-v1.0-hybrid 30 QLLPIANVGRMMKQILPPNAKISKEAKQTMQECVSEFISFVTGEASDKCRKERRKTVNGDDICCALGTLGFDDYAALLRRYLHRYR 115 79************************************************************************************ PP NF-YB 92 elege 96 + eg+ mrna06857.1-v1.0-hybrid 116 DQEGA 120 *9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 5.0E-34 | 30 | 125 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 9.1E-44 | 30 | 132 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.7E-26 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-15 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-15 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 1.2E-15 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MVDNSGGSVP NNCDHGQGDI NSTEQPDPGQ LLPIANVGRM MKQILPPNAK ISKEAKQTMQ 60 ECVSEFISFV TGEASDKCRK ERRKTVNGDD ICCALGTLGF DDYAALLRRY LHRYRDQEGA 120 EHRANIGNNN NEDELKLLAN NILSTAQEQR IIMIMNQYDH PDHHDIQKT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-37 | 30 | 116 | 6 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-37 | 30 | 116 | 6 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna06857.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004296821.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O82248 | 2e-49 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2P6QY85 | 5e-96 | A0A2P6QY85_ROSCH; Putative transcription factor Hap3/NF-YB family | ||||
STRING | XP_004296821.1 | 1e-125 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 8e-42 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna06857.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|