PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna06460.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 224aa MW: 25092.2 Da PI: 8.5541 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 159.3 | 1.6e-49 | 4 | 128 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+e++++ ++PwdLp e+e yfFs++++ky++g+r+nr+t+sgyWkat mrna06460.1-v1.0-hybrid 4 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEINVCVYDPWDLPGD---LEQERYFFSNKESKYPNGNRTNRVTSSGYWKAT 85 79****************************.89***************54...46799**************************** PP NAM 87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 g+dk+++s+ +++ vg kk+Lvfy+g+ap+g+ktdWvmhey+l mrna06460.1-v1.0-hybrid 86 GSDKKIVSArRNNIVGKKKSLVFYRGKAPNGSKTDWVMHEYSL 128 *******9867778***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.24E-58 | 2 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.48 | 4 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.8E-25 | 5 | 128 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MTRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEIN VCVYDPWDLP GDLEQERYFF 60 SNKESKYPNG NRTNRVTSSG YWKATGSDKK IVSARRNNIV GKKKSLVFYR GKAPNGSKTD 120 WVMHEYSLVN NLGTRALSTE NSINQQGNWV LCRIFLKKRS SHKDEDNLLN YDGFKVNNAE 180 KGQLQITRTT PVSSCSSCSS CSGITEVSSS HEAGDEEISG CAH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-48 | 4 | 163 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-48 | 4 | 163 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-48 | 4 | 163 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-48 | 4 | 163 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
4dul_A | 2e-48 | 4 | 163 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-48 | 4 | 163 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna06460.1-v1.0-hybrid |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004297508.1 | 1e-167 | PREDICTED: NAC transcription factor 29 | ||||
Swissprot | Q9FY93 | 8e-75 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2P6P4P6 | 1e-138 | A0A2P6P4P6_ROSCH; Putative transcription factor NAM family | ||||
STRING | XP_004297508.1 | 1e-167 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-76 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna06460.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|