PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04797.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 231aa    MW: 25950.7 Da    PI: 5.3254
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04797.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.44e-18134168135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  mrna04797.1-v1.0-hybrid 134 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 168
                              *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.517128164IPR000679Zinc finger, GATA-type
SMARTSM004016.3E-16128178IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.9E-14132166IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.85E-14132192No hitNo description
CDDcd002027.03E-14133180No hitNo description
PfamPF003205.8E-16134168IPR000679Zinc finger, GATA-type
PROSITE patternPS003440134159IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEDMYGLPSS SSSAQPQVDY FPIDDLLDLS NDEIFSNSSS TSSADSHPHY FPPPPPPAGL  60
FNPTASTDFT NALCLPSEDV AELEWLSRFV DDSFTDFPPP ELPLPNDKSF SNPNRPHNTK  120
PVCREENPEP IRRCTHCASE KTPQWRTGPL GPKTLCNACG VRYKSGRLVP EYRPAASPTF  180
VLTQHSNSHR KVMELRRQKE VSSSSQQQQQ AEEEEQQRRF YLHPNAFRVS *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna04797.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306966.11e-170PREDICTED: GATA transcription factor 4-like
SwissprotO497433e-60GATA4_ARATH; GATA transcription factor 4
TrEMBLA0A2P6SFL24e-94A0A2P6SFL2_ROSCH; GATA transcription factor
STRINGXP_004306966.11e-169(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135501925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.13e-57GATA transcription factor 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]