PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04172.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family CO-like
Protein Properties Length: 471aa    MW: 52035.1 Da    PI: 6.9027
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04172.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.21.4e-07102143439
                 zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 
                              r+C+++ + + + +C+ ++ +lC  C  ++H        H++
  mrna04172.1-v1.0-hybrid 102 RVCDTCRSAPCTVYCRADSAYLCSGCDATIHAAnrvasrHER 143
                              79*****************************55567777765 PP

2zf-B_box284.6e-09144189342
                 zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                               ++C+ +e+ ++ l C+ +   lC  C   +H+       H++vp+
  mrna04172.1-v1.0-hybrid 144 VWVCEACERAPAALLCKADAASLCTACDADIHSAnplarrHQRVPI 189
                              689*****************************66899999**9997 PP

3CCT69.96.3e-24401444144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  mrna04172.1-v1.0-hybrid 401 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 444
                              9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.63799146IPR000315B-box-type zinc finger
SMARTSM003365.6E-899146IPR000315B-box-type zinc finger
CDDcd000211.33E-8102146No hitNo description
PROSITE profilePS5011911.334142189IPR000315B-box-type zinc finger
PfamPF006433.2E-7143189IPR000315B-box-type zinc finger
CDDcd000211.40E-9145189No hitNo description
SMARTSM003363.8E-10147189IPR000315B-box-type zinc finger
PROSITE profilePS5101716.648401443IPR010402CCT domain
PfamPF062039.9E-18401443IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MQGWRGREVE VGEVGEALFS KPRFRSKRPK PKHLLRAPHP TPAELSQPQD NATITPPLPP  60
PSLHNSIITS KTFKDLRVRR KQHNNMLKEE SNGAAAANSW ARVCDTCRSA PCTVYCRADS  120
AYLCSGCDAT IHAANRVASR HERVWVCEAC ERAPAALLCK ADAASLCTAC DADIHSANPL  180
ARRHQRVPIL PISGGQIVVG STPADTTEDG FLSQEGDEEA MDEEDEDEAA SWLLLNPVKN  240
SNSHNSNNNN NPNSNNNGFF FGVEVDEYLD LVEYNSSDQN QFSGTTATND QHSYGVPHKI  300
SYGGDSVVPV QYGEGKVTQM QMQQKHNFHQ LGMEYESSKA AYGYDGSISH TVSVSSMDVG  360
VVPDSTMSEM SVCHPRTPKG TIDLFNGPTI QIPTQLSPMD REARVLRYRE KKKTRKFEKT  420
IRYASRKAYA ETRPRIKGRF AKRTDIDVEV DQMFSTSLMG ETGYGIVPSY *
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna04172.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ3776160.0FJ377616.1 Fragaria x ananassa CONSTANS mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304173.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-145COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLB6VEH40.0B6VEH4_FRAAN; CONSTANS
STRINGXP_004304173.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-118CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]