PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03816.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 183aa    MW: 20062.7 Da    PI: 8.1027
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03816.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer95.73.7e-30114168359
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              +vrY eC+kNhAa +Gg+avDGC+Efm+s geeg +aal+CaACgCHRnFHRreve+
  mrna03816.1-v1.0-hybrid 114 NVRYVECQKNHAAGVGGYAVDGCREFMAS-GEEG-TAALTCAACGCHRNFHRREVET 168
                              79**************************9.6664.689****************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-15111177IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.0E-28114166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-25116166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.626117165IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MLSKWARWNY DGKEECSPKS MKGIDKLSGG GCHSPHKKLC HRDTPWKLSE DLPDMLYIGV  60
HGVRLSTTLG AGLPGALSES FLGTLRDPRT ERMIQVKRQV VVRREEPSSY TIRNVRYVEC  120
QKNHAAGVGG YAVDGCREFM ASGEEGTAAL TCAACGCHRN FHRREVETVC ECSSPTSTNE  180
AA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna03816.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-22mini zinc finger 2