PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03742.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family CO-like
Protein Properties Length: 451aa    MW: 50333.9 Da    PI: 5.5577
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03742.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.81.3e-092467340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                             +r C+ + +k+++++C  ++ +lC+ C ++ H+       H++v
  mrna03742.1-v1.0-hybrid 24 ARACDSCIKKRARWYCAADDAFLCQACDSSVHSAnqlarrHERV 67
                             578*****************************657788888876 PP

2CCT67.92.6e-23393436144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  mrna03742.1-v1.0-hybrid 393 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 436
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.9E-112269IPR000315B-box-type zinc finger
PROSITE profilePS5011911.1062269IPR000315B-box-type zinc finger
PfamPF006431.2E-72467IPR000315B-box-type zinc finger
CDDcd000212.71E-92569No hitNo description
PfamPF062037.7E-18393435IPR010402CCT domain
PROSITE profilePS5101716.083393435IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MISNKKASAS ASAATANVVG GKTARACDSC IKKRARWYCA ADDAFLCQAC DSSVHSANQL  60
ARRHERVRLK TASSIKSTTN SGSCDKSEVP SWHRGFTRKP RTPRGQGKSA APRNRFPLVP  120
EVGADDLSYE ENEEEQLLYR VPIYDPFVAE LCTSPNSNAV SNDLNGNESK AVSMPNYYGV  180
GNRNSPSSHG FDLPSDMDLA EFAADVDSLL GRGLDDHECF GMEGLGLTDC HEKESTTTEE  240
GTTERVKVED EEDAYMACQA ETEMDLMREP FVLNFEDYDD SPASCAEDEE EEEEEDHKLG  300
VRMSHGETKS SCQEHKSCKK RKIFLRLDYD EVITKWDSQS NGSPFAFGDR PDIDYDCLPD  360
FMGTASGAEL LHYPYGDLNR VIGLHPTMTD GGREARVSRY REKRRTRLFS KKIRYEVRKL  420
NAEKRPRMKG RFVKRASFAA TGSTFPMLTK *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1403419RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna03742.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7844451e-174KP784445.1 Rosa chinensis putative CO/CONSTANS protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299078.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A2P6R1Q10.0A0A2P6R1Q1_ROSCH; Putative transcription factor C2C2-CO-like family
STRINGXP_004299078.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.19e-98B-box type zinc finger protein with CCT domain