PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03079.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Nin-like
Protein Properties Length: 248aa    MW: 29044.2 Da    PI: 9.0162
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03079.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK48.71.5e-15157202348
                   RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                              ++++ledl+ yF+l+i++A+ +L +   ++Kr C ++G+ RWP+Rk
  mrna03079.1-v1.0-hybrid 157 ASMKLEDLRVYFHLSIEEASEKLRLPIAIVKRLCHKFGVCRWPSRK 202
                              6899*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.083141227IPR003035RWP-RK domain
PfamPF020422.1E-13159202IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGSHRHAIQE RRASVLNNYG ACKEPIYERF DFHSKSLNEV KHFLTHYCEE RKAEGYIRQP  60
DHVQSFLQGF YVAMEDEDEW EEVLSYPEEF IYEVFDIEDF GPPNSNAMQG LHVEKASSSK  120
GKGKMRGRPP KLHRFYLAEQ RERAAKMKLD AQRERAASMK LEDLRVYFHL SIEEASEKLR  180
LPIAIVKRLC HKFGVCRWPS RKQLKAISKE ISSLQPMLLS YRKGTRDYMA ARIESLEKER  240
AILLHYS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna03079.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011469544.11e-124PREDICTED: uncharacterized protein LOC105352974
TrEMBLA0A2P6PER92e-64A0A2P6PER9_ROSCH; Putative transcription factor Nin-like family
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.17e-10RWP-RK domain-containing protein