PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01346.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 419aa    MW: 45499.8 Da    PI: 10.1077
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01346.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP111.71.1e-3480290289
                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                              a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i++ tgt++++as+  a+  s+s++ ss+
  mrna01346.1-v1.0-hybrid  80 APKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIATTGTGTIPASALAAAGGSVSQQGSSI 165
                              789******************************************************************99966666666666666 PP

                      TCP  88 g..................................................................................... 88 
                              +                                                                                     
  mrna01346.1-v1.0-hybrid 166 Saglyqktddlgssggrtswamvggnlgrphvaaatglwppagfgfssqssssgpsttnlggtesssnylqkiglpgfdlpvtnmg 251
                              66777666666666666666666666666666666666666666666666666666666666666666666666666666666666 PP

                      TCP  89 ......................................k 89 
                                                                     
  mrna01346.1-v1.0-hybrid 252 pmsftsilgggsqqlpglelglsqdghlgvlnsqayqiY 290
                              666666666666666666666666666666666666551 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.2E-3085321IPR005333Transcription factor, TCP
PROSITE profilePS5136927.25786140IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDPKASKQPQ EIPSFLSLPQ PQQQQQQHQQ HHQQLPNTMS ENNNNNNHNH NNNNNVVKPA  60
EIKDFQIVVA DKDETKKQLA PKRSSNKDRH TKVEGRGRRI RMPALCAARI FQLTRELGHK  120
SDGETIQWLL QQAEPSIIAT TGTGTIPASA LAAAGGSVSQ QGSSISAGLY QKTDDLGSSG  180
GRTSWAMVGG NLGRPHVAAA TGLWPPAGFG FSSQSSSSGP STTNLGGTES SSNYLQKIGL  240
PGFDLPVTNM GPMSFTSILG GGSQQLPGLE LGLSQDGHLG VLNSQAYQIY QQMGHARVHH  300
HQQQQQQHHQ QQHQHQQQQQ APSSKDDSQG SGQWELCTVK QMVWVLGLTA ALIQRCVDYS  360
KRSKADICTR LKVRTSLCSA PYDADEGAPL PQRTPAASPT TFPPRRVRRI PVFRRGPL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna01346.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9348360.0HG934836.1 Rosa hybrid cultivar microsatellite DNA locus WGR17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468196.10.0PREDICTED: transcription factor TCP20
SwissprotQ9LSD52e-75TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A1Q1NA400.0A0A1Q1NA40_FRAVE; PCF transcription factor 17
STRINGXP_004304531.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33393269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.19e-57TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]