PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna00537.1-v1.0-hybrid
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 559aa    MW: 62016.9 Da    PI: 7.63
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna00537.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                              SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              +yps+ ++  LA+++gLt +q+ +WF N+R ++
  mrna00537.1-v1.0-hybrid 278 PYPSEPQKLALAASTGLTVKQINNWFINQRKRH 310
                              8*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512138.94230250IPR005539ELK domain
PROSITE profilePS5007112.714250313IPR001356Homeobox domain
SMARTSM003899.3E-13252317IPR001356Homeobox domain
CDDcd000861.69E-12262314No hitNo description
PfamPF059201.1E-15270309IPR008422Homeobox KN domain
PROSITE patternPS000270288311IPR017970Homeobox, conserved site
PROSITE profilePS5103823.853372487IPR001025Bromo adjacent homology (BAH) domain
SMARTSM004391.8E-41372487IPR001025Bromo adjacent homology (BAH) domain
CDDcd047141.69E-56374507No hitNo description
PfamPF014261.6E-23374486IPR001025Bromo adjacent homology (BAH) domain
SuperFamilySSF579031.55E-7482513IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA: finger, RING/FYVE/PHD-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003682Molecular Functionchromatin binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5z8l_A1e-1043525131170Chromatin remodeling protein EBS
Search in ModeBase
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4137760.0HQ413776.1 Fragaria vesca knotted-like homeobox KNOX3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267003.10.0homeobox protein SBH1-like
TrEMBLF5A6B30.0F5A6B3_FRAVE; Knotted-like homeobox KNOX3
STRINGXP_004309450.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.12e-65KNOX/ELK homeobox transcription factor