PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00004461.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 134aa MW: 14481.7 Da PI: 4.6514 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 42.3 | 1.8e-13 | 15 | 57 | 12 | 56 |
AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 g++ AeIrdps ng +r +lg+f taeeAa+a+++a+ ++g+ FANhyb_rscf00004461.1.g00001.1 15 GGKYGAEIRDPSRNG--ARLWLGTFETAEEAARAYDRAAFGFRGH 57 599*******98887..**********************988886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51032 | 19.638 | 1 | 64 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 4.05E-18 | 11 | 65 | IPR016177 | DNA-binding domain |
SMART | SM00380 | 1.5E-22 | 14 | 71 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 4.7E-7 | 15 | 57 | IPR001471 | AP2/ERF domain |
CDD | cd00018 | 1.04E-21 | 16 | 65 | No hit | No description |
Gene3D | G3DSA:3.30.730.10 | 4.0E-23 | 16 | 66 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MEGERAEEGF GSGRGGKYGA EIRDPSRNGA RLWLGTFETA EEAARAYDRA AFGFRGHLAI 60 LNFPNEYQYH NPSTSASSFV ASHSVSSSSS TSSTSVSSAP AGGGMQFGNE EGRLIEFEYL 120 DNMVLEELLE GQRK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gcc_A | 2e-20 | 16 | 64 | 12 | 60 | ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1 |
2gcc_A | 2e-20 | 16 | 64 | 15 | 63 | ATERF1 |
3gcc_A | 2e-20 | 16 | 64 | 15 | 63 | ATERF1 |
5wx9_A | 3e-20 | 16 | 67 | 24 | 75 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011457997.1 | 8e-58 | PREDICTED: ethylene-responsive transcription factor ERF098-like | ||||
Swissprot | Q9LTC5 | 1e-34 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | A0A3Q8TEE3 | 1e-59 | A0A3Q8TEE3_FRAAN; Transcription factor ERF77 | ||||
STRING | XP_004292209.1 | 1e-57 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF270 | 33 | 215 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23230.1 | 2e-21 | ERF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|