PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00002653.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 93aa MW: 10821.1 Da PI: 7.0269 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 49.8 | 8.4e-16 | 1 | 44 | 54 | 97 |
NF-YB 54 cqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 c++e+rkt+ngdd++ al+tlGf+dy++ l+ yl++ r+ eg++ FANhyb_rscf00002653.1.g00001.1 1 CRKERRKTVNGDDICCALGTLGFDDYAALLRRYLHRCRDQEGAE 44 99*************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.3E-14 | 1 | 57 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 3.8E-5 | 1 | 14 | No hit | No description |
SuperFamily | SSF47113 | 1.2E-10 | 1 | 52 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 3.8E-5 | 20 | 38 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
CRKERRKTVN GDDICCALGT LGFDDYAALL RRYLHRCRDQ EGAEHRANIG KNNNEDELKL 60 LANNNILSTA QEQRIIMIMN QYDHPDHHDI QKT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004296821.1 | 4e-59 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O82248 | 2e-15 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2P6QY85 | 2e-42 | A0A2P6QY85_ROSCH; Putative transcription factor Hap3/NF-YB family | ||||
STRING | XP_004296821.1 | 2e-58 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 8e-18 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|