PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001246.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Dof
Protein Properties Length: 303aa    MW: 32852.1 Da    PI: 8.785
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001246.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.4e-3941102263
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                     ke+al+cprC+stntkfCyynnysl+qPryfCkaCrryWt GG+lrn+PvGgg+rknk+sss
  FANhyb_rscf00001246.1.g00001.1  41 KESALNCPRCNSTNTKFCYYNNYSLTQPRYFCKACRRYWTDGGSLRNIPVGGGSRKNKRSSS 102
                                     67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-273493IPR003851Zinc finger, Dof-type
PfamPF027011.7E-334399IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0784599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDTAQWPQGI VVKPIEEIVT NTCPKPSSAN NLERKLARPQ KESALNCPRC NSTNTKFCYY  60
NNYSLTQPRY FCKACRRYWT DGGSLRNIPV GGGSRKNKRS SSSSSSTPTS NISNNSSKRL  120
PDLIQPQGNQ GNNQGQDLNL GFPSNQVFAH HQIPNIDQNS DKNNNSSSTS TTTTASHLSA  180
LELLTGLTSR GLNSFMPMPV PNSDPNSNNN SGSVYTSGFP MSELMIKPTL NFSLDGLGSG  240
YGSALQGHHV QENSGRLLFP FEDLKQVSGS GGGIDHHQQN NKEHHHGGDS TGYWTGMLGG  300
GSW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300484.10.0PREDICTED: dof zinc finger protein DOF4.6-like
SwissprotQ8LAP81e-63DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A2P6P3Y41e-174A0A2P6P3Y4_ROSCH; Putative transcription factor C2C2-Dof family
STRINGXP_004300484.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.12e-47Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]