PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00000582.1.g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 146aa MW: 16605.9 Da PI: 8.0643 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123 | 9.7e-39 | 53 | 111 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k FANhyb_rscf00000582.1.g00005.1 53 PEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSKP 111 68999***************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 7.0E-30 | 52 | 110 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.8E-32 | 55 | 110 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.425 | 57 | 111 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 59 | 95 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010214 | Biological Process | seed coat development | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MAEVSSGQGV PGIKLFGTTI TLQNNQVVVK DDHHREQKKA DDVHDQTVEM KRPEKIIPCP 60 RCKSMETKFC YFNNYNVNQP RHFCKGCQRY WTAGGALRNV PVGAGRRKSK PPCRELVGFP 120 EACMYEASEV VHQFELEGVV EEWHVA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00166 | DAP | Transfer from AT1G29160 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004293942.1 | 1e-101 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
Swissprot | P68350 | 1e-50 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A2P6Q4P0 | 4e-95 | A0A2P6Q4P0_ROSCH; Putative transcription factor C2C2-Dof family | ||||
STRING | XP_004293942.1 | 1e-101 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 4e-53 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|