PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_rscf00000441.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

M-type_MADS

Protein Properties

Length: 94aa MW: 10867 Da PI: 11.0448

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_rscf00000441.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.3	1.5e-31	42	92	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELS+LC+aeva+i+fss+g+lyeys+ FANhyb_rscf00000441.1.g00001.1 42 KRIENTTNRQVTFCKRRNGLLKKAYELSILCEAEVALIVFSSRGRLYEYSN 92 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.389	34	94	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.4E-41	34	93	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.79E-29	34	93	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.05E-37	35	93	No hit	No description
PROSITE pattern	PS00350	0	36	90	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.4E-33	36	56	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.9E-27	43	90	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.4E-33	56	71	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.4E-33	71	92	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MKVSDFKIVG LLRLNILKMA QTTSKLMLAR LLKMGRGKIE IKRIENTTNR QVTFCKRRNG 60 LLKKAYELSI LCEAEVALIV FSSRGRLYEY SNNK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
6c9l_A	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	3e-20	34	92	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007146364.1	9e-37	hypothetical protein PHAVU_006G034400g
Swissprot	P17839	2e-36	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	A0A0L9VF45	2e-36	A0A0L9VF45_PHAAN; Uncharacterized protein
STRING	POPTR_0011s03150.1	2e-36	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	9e-39	MIKC_MADS family protein

Publications ? help Back to Top
Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]