PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462969128 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 82aa MW: 8971.29 Da PI: 9.1038 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 75.9 | 6.8e-24 | 11 | 71 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 F+ k+y ++ed+ ++ +i w + +nsf+v d+ f++++Lp +Fkh+nf+SFvRQLn+Y F 462969128 11 FVWKTYMMVEDPGTDGVIGWGRGNNSFIVADPFVFSQTLLPAHFKHNNFSSFVRQLNTYIF 71 9**********************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 2.1E-15 | 7 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 9.4E-26 | 8 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.63E-22 | 10 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.8E-13 | 11 | 34 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 5.3E-19 | 11 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-13 | 49 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-13 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MAAGGGAAAP FVWKTYMMVE DPGTDGVIGW GRGNNSFIVA DPFVFSQTLL PAHFKHNNFS 60 SFVRQLNTYI FGVREIFLLG GK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5w_B | 7e-18 | 8 | 71 | 1 | 64 | Putative transcription factor |
5d5x_B | 7e-18 | 8 | 71 | 1 | 64 | Putative transcription factor |
5d5x_E | 7e-18 | 8 | 71 | 1 | 64 | Putative transcription factor |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462969128 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX540975 | 3e-77 | JX540975.1 Paspalum vaginatum clone StvSingle_HKZDOCN01AUS53 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004965592.1 | 1e-43 | heat stress transcription factor C-2b | ||||
Swissprot | Q0DBL6 | 2e-37 | HFC2B_ORYSJ; Heat stress transcription factor C-2b | ||||
TrEMBL | A0A368QVH6 | 3e-42 | A0A368QVH6_SETIT; Uncharacterized protein | ||||
STRING | Pavir.J36148.1.p | 2e-38 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24520.1 | 6e-29 | heat shock transcription factor C1 |