PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462964844 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 274aa MW: 30087.9 Da PI: 8.8937 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 167.1 | 6.1e-52 | 6 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..... 95 lppGfrFhPtdeel+ +yL+k+++++++++ vi+evdiyk++PwdLp+k+ +e ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++s+ 462964844 6 LPPGFRFHPTDEELILHYLRKRAAATPCPA-PVIAEVDIYKFDPWDLPAKAVFGEGEWYFFSPRDRKYPNGVRPNRAAGSGYWKATGTDKPITSSaaers 104 79***************************9.89***************87778899**************************************977766 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +g+kk Lvfy+gr pkg kt+W+mheyrl 462964844 105 SSAMIGVKKALVFYRGRPPKGMKTSWIMHEYRL 137 6666***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.66E-64 | 4 | 170 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 61.313 | 6 | 170 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.3E-27 | 7 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 274 aa Download sequence Send to blast |
MMPNPLPPGF RFHPTDEELI LHYLRKRAAA TPCPAPVIAE VDIYKFDPWD LPAKAVFGEG 60 EWYFFSPRDR KYPNGVRPNR AAGSGYWKAT GTDKPITSSA AERSSSAMIG VKKALVFYRG 120 RPPKGMKTSW IMHEYRLADA LNAANTYRPM RFKNASMRLD DWVLCRIYKK TTPQLTYSSS 180 PPLDADEPLM DGAGFTSHGQ QHGNSAAYAD DVAGGQLPRP PSISDYLVDY AMSELFESAP 240 APQLGTDAGS SGGAAAQFFI GNDSSGVQQS SHKR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-71 | 6 | 172 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-71 | 6 | 172 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-71 | 6 | 172 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-71 | 6 | 172 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swm_B | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swm_C | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swm_D | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swp_A | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swp_B | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swp_C | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
3swp_D | 5e-71 | 6 | 172 | 20 | 170 | NAC domain-containing protein 19 |
4dul_A | 5e-71 | 6 | 172 | 17 | 167 | NAC domain-containing protein 19 |
4dul_B | 5e-71 | 6 | 172 | 17 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. | |||||
UniProt | Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-A1) and one extra pseudogene (NAM-B1) (PubMed:17124321). Plays a weaker role in terminal senescence than NAM-A1. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00333 | DAP | Transfer from AT3G04070 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462964844 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU972600 | 1e-142 | EU972600.1 Zea mays clone 384237 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025816084.1 | 1e-121 | NAC transcription factor 29-like | ||||
Swissprot | A0SPJ6 | 2e-85 | NAMB2_TRITD; NAC transcription factor NAM-B2 | ||||
Swissprot | Q8H4S4 | 6e-85 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
TrEMBL | A0A1E5UWU9 | 1e-121 | A0A1E5UWU9_9POAL; NAC transcription factor NAM-B2 | ||||
STRING | Pavir.Ea00837.1.p | 1e-118 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1237 | 36 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.1 | 9e-85 | NAC domain containing protein 47 |
Publications ? help Back to Top | |||
---|---|---|---|
|