PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462964151 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 123aa MW: 14049.1 Da PI: 10.6072 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.7 | 2.5e-13 | 39 | 86 | 5 | 52 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 +r+rr++kNRe+A rsR+RK+a++ eLe + +L++eN++L+ e +++ 462964151 39 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENERLRAEEKKI 86 79****************************************876654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.5E-13 | 35 | 99 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.381 | 37 | 86 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 9.9E-12 | 39 | 86 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.1E-13 | 39 | 86 | No hit | No description |
CDD | cd14707 | 1.31E-18 | 39 | 93 | No hit | No description |
SuperFamily | SSF57959 | 5.0E-11 | 39 | 85 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 42 | 57 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MTQAEMMTCI GNGGMVRNGG NARKRDSPED GCTEKTVERR QRRMIKNRES AARSRARKQA 60 YTVELEAELN QLKEENERLR AEEKKILLSK KQMLVEKMIE QSKENVSAKK SGGGLRRCGS 120 SMW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462964151 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF314701 | 2e-82 | KF314701.1 Setaria italica clone SiABRE hypothetical protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025818302.1 | 7e-73 | bZIP transcription factor ABI5 homolog | ||||
Swissprot | Q8RZ35 | 3e-53 | ABI5_ORYSJ; bZIP transcription factor ABI5 homolog | ||||
TrEMBL | A0A3L6SMA9 | 5e-72 | A0A3L6SMA9_PANMI; Protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 | ||||
STRING | Pavir.J35078.1.p | 1e-68 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3830 | 35 | 58 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G36270.1 | 5e-25 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|