PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462952334 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 216aa MW: 24338.5 Da PI: 9.5216 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.4 | 4.3e-15 | 68 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEde l +av + g++Wk+Ia+ ++ Rt+ qc +rwqk+l 462952334 68 KGGWTIEEDETLHRAVDAFDGRHWKKIAEFLP-DRTEVQCLHRWQKVL 114 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 62.6 | 7.9e-20 | 120 | 166 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++++d vk++G++ W+ Ia+ + gR +kqc++rw+++l 462952334 120 KGPWTQEEDDIIIDMVKKHGPKKWSVIAKSLD-GRIGKQCRERWHNHL 166 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 33 | 1.4e-10 | 172 | 205 | 1 | 36 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36 + +WT eE+ l++a++ +G++ W+ Ia+ ++ gR 462952334 172 KEAWTVEEERVLANAHRVYGNK-WAEIAKLLP-GRN 205 579*******************.*********.995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.447 | 63 | 114 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.01E-15 | 64 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.6E-12 | 67 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-13 | 68 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-22 | 70 | 122 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.86E-11 | 71 | 114 | No hit | No description |
PROSITE profile | PS51294 | 32.246 | 115 | 170 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.48E-27 | 117 | 205 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-18 | 119 | 168 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-18 | 120 | 166 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.88E-15 | 122 | 166 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-27 | 123 | 170 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.92 | 171 | 216 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-13 | 171 | 205 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.0045 | 171 | 215 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.7E-9 | 172 | 204 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.36E-6 | 174 | 208 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MGAMPAVKVE EGDGAAGNWG NLAAWSPSEL ASEAASYGGG ARMSTVLSSP MDSDSGRRRT 60 SGPVRRAKGG WTIEEDETLH RAVDAFDGRH WKKIAEFLPD RTEVQCLHRW QKVLNPELRK 120 GPWTQEEDDI IIDMVKKHGP KKWSVIAKSL DGRIGKQCRE RWHNHLDPQI RKEAWTVEEE 180 RVLANAHRVY GNKWAEIAKL LPGRNIWQSA EVGKKT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 2e-61 | 67 | 204 | 5 | 142 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-61 | 67 | 204 | 5 | 142 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462952334 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025809062.1 | 1e-115 | transcription factor MYB3R-2-like isoform X1 | ||||
Refseq | XP_025809063.1 | 1e-118 | transcription factor MYB3R-2-like isoform X2 | ||||
Swissprot | Q0JHU7 | 6e-90 | MB3R2_ORYSJ; Transcription factor MYB3R-2 | ||||
TrEMBL | A0A0A9DCG7 | 1e-114 | A0A0A9DCG7_ARUDO; Uncharacterized protein | ||||
STRING | Si021484m | 1e-106 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3099 | 38 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 2e-89 | myb domain protein 3r-5 |
Publications ? help Back to Top | |||
---|---|---|---|
|