PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951506
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 540aa    MW: 63329.6 Da    PI: 9.0093
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951506genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.31.8e-5461341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++vl+++g+
  462951506   6 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVLHHGGR 104
                79****************************.99**************85335566888****************************************** PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLv+y+grap+g++tdWvmheyrl
  462951506 105 AIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 134
                ****************************98 PP

2NAM101.21.4e-3114621757128
        NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                +wyfF +rd+ky++g r+nrat++gyWk+tgkd++vl+++g+++g+kktLv+y+grap+g++tdWvmheyrl
  462951506 146 QWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVLHHGGRAIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 217
                8*********************************************************************98 PP

3NAM44.16.4e-14276316142
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv 42 
                lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+
  462951506 276 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKS 316
                79****************************.99*******96 PP

4NAM171.82.1e-533314581128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L  k  + ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v   +++
  462951506 331 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDSEWYFFGPRDRKYPNGCRTNRATREGYWKSTGKDRRVNY-QNR 428
                79****************************.99**************84335566899*************************************9.889 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +g+kktLv+ykgrap+g +t+Wvmheyr+
  462951506 429 SIGMKKTLVYYKGRAPQGLRTSWVMHEYRI 458
                9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-583141IPR003441NAC domain
PROSITE profilePS5100555.5346151IPR003441NAC domain
PfamPF023654.2E-297134IPR003441NAC domain
PfamPF023652.1E-15144217IPR003441NAC domain
SuperFamilySSF1019416.8E-38145240IPR003441NAC domain
PROSITE profilePS5100531.407147240IPR003441NAC domain
SuperFamilySSF1019412.62E-14270316IPR003441NAC domain
PROSITE profilePS510059.694276315IPR003441NAC domain
PfamPF023658.7E-8277300IPR003441NAC domain
SuperFamilySSF1019412.75E-62324481IPR003441NAC domain
PROSITE profilePS5100559.045331481IPR003441NAC domain
PfamPF023656.0E-29332458IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MARVGLPPGF RFHPTDEELV NYYLKRKIHG LKIELDIIPE VDLYKCEPWE LADKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVLH HGGRAIGMKK TLVYYRGRAP  120
QGVRTDWVMH EYRLDDKDAE DTLPIQWYFF GPRDRKYPNG FRTNRATRAG YWKSTGKDRR  180
VLHHGGRAIG MKKTLVYYRG RAPQGVRTDW VMHEYRLDDK DAEDTLPIQD TYALCRVFKK  240
NAICTEVDDL QLQAQQRERS ARKEASCWEL MAPADLPPGF RFHPTDEELV NYYLKRKVHG  300
LSIELDIIPE VDLYKSRKEA SCWELMAPAD LPPGFRFHPT DEELVNYYLK RKVHGLSIEL  360
DIIPEVDLYK CEPWELAEKS FLPSRDSEWY FFGPRDRKYP NGCRTNRATR EGYWKSTGKD  420
RRVNYQNRSI GMKKTLVYYK GRAPQGLRTS WVMHEYRIEE SECDNTMGIQ DSYALCRVFK  480
KTVAFSEFEK QGECSTSEGK GNQEKPTNFG DAGQSSGSNE QGKDNSWMQF IADDLWCNKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-49148112167NO APICAL MERISTEM PROTEIN
1ut4_B2e-49148112167NO APICAL MERISTEM PROTEIN
1ut7_A2e-49148112167NO APICAL MERISTEM PROTEIN
1ut7_B2e-49148112167NO APICAL MERISTEM PROTEIN
3swm_A2e-49148115170NAC domain-containing protein 19
3swm_B2e-49148115170NAC domain-containing protein 19
3swm_C2e-49148115170NAC domain-containing protein 19
3swm_D2e-49148115170NAC domain-containing protein 19
3swp_A2e-49148115170NAC domain-containing protein 19
3swp_B2e-49148115170NAC domain-containing protein 19
3swp_C2e-49148115170NAC domain-containing protein 19
3swp_D2e-49148115170NAC domain-containing protein 19
3ulx_A2e-49249011174Stress-induced transcription factor NAC1
4dul_A2e-49148112167NAC domain-containing protein 19
4dul_B2e-49148112167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462951506
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280590.0KJ728059.1 Zea mays clone pUT6205 NAC transcription factor (NAC121) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803497.11e-140NAC domain-containing protein 45-like
SwissprotQ9FFI52e-81NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A1E5WFF40.0A0A1E5WFF4_9POAL; NAC domain-containing protein 45
STRINGOPUNC09G17350.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-102NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]