PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462948760 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 190aa MW: 21825.3 Da PI: 10.3103 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.2 | 2.1e-19 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTt+Ed+llv+ v+q+G g+W+++++ g++R++k+c++rw +yl 462948760 17 KGPWTTQEDKLLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 64 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.2 | 1.7e-17 | 70 | 114 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++ 462948760 70 RGKITPQEETIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114 8999******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.408 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.99E-30 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.4E-16 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.3E-18 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-23 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.27E-11 | 19 | 64 | No hit | No description |
PROSITE profile | PS51294 | 25.427 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 7.9E-16 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-15 | 70 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-24 | 72 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.08E-10 | 74 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MEGQLSWGRQ EVDGWRKGPW TTQEDKLLVE HVRQHGEGRW NSVSKLTGLK RSGKSCRLRW 60 VNYLRPDLKR GKITPQEETI IVQLHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP 120 SKNIERARAR FLKQRREMQS QQQQFQLVGK DEDKHDATRV DGTVGDEEDR GSAVVDDNAA 180 HADDDGGGGG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-27 | 17 | 117 | 27 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462948760 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK109620 | 1e-140 | AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004978126.1 | 3e-96 | transcription repressor MYB6 | ||||
Swissprot | Q9C9G7 | 8e-50 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | A0A3L6PVQ3 | 3e-96 | A0A3L6PVQ3_PANMI; Transcription repressor MYB6-like | ||||
STRING | Pavir.Ga01308.1.p | 1e-96 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3243 | 35 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G13480.1 | 7e-67 | myb domain protein 79 |
Publications ? help Back to Top | |||
---|---|---|---|
|