PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462944268

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 101aa MW: 11601.5 Da PI: 10.0043

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462944268	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.3	1.5e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEd++l + ++++G g+W+++++ g+ R++k+c++rw +yl 462944268 14 RGLWSPEEDDKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61 789*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.9E-27	8	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.858	9	65	IPR017930	Myb domain
SMART	SM00717	7.3E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.76E-22	16	88	IPR009057	Homeodomain-like
CDD	cd00167	4.13E-11	17	61	No hit	No description
PROSITE profile	PS50090	4.008	62	86	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	7.6E-9	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MARRATGQKK KLRRGLWSPE EDDKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY 60 LRPDLKRGAF SQEEEDLIIH LHSMLGNKCV PAETSIHAFL N

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-16	11	88	24	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	7	13	QKKKLRR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269\|PubMed:16005292, ECO:0000269\|PubMed:19401413, ECO:0000269\|PubMed:22708996, ECO:0000269\|PubMed:23741471, ECO:0000269\|PubMed:28207974}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462944268

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT034016	4e-92	BT034016.1 Zea mays full-length cDNA clone ZM_BFc0036C19 mRNA, complete cds.
GenBank	BT035399	4e-92	BT035399.1 Zea mays full-length cDNA clone ZM_BFb0059D04 mRNA, complete cds.
GenBank	BT040989	4e-92	BT040989.1 Zea mays full-length cDNA clone ZM_BFc0162L22 mRNA, complete cds.
GenBank	BT067525	4e-92	BT067525.1 Zea mays full-length cDNA clone ZM_BFc0072I17 mRNA, complete cds.
GenBank	KJ727614	4e-92	KJ727614.1 Zea mays clone pUT5525 MYB transcription factor (MYB23) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004958441.1	4e-56	transcription factor MYB61
Swissprot	Q8VZQ2	7e-46	MYB61_ARATH; Transcription factor MYB61
TrEMBL	Q8S438	2e-55	Q8S438_SORBI; P-type R2R3 Myb protein (Fragment)
STRING	Sb02g040480.1	1e-54	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3092	33	85

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G57560.1	4e-49	myb domain protein 50

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Matías-Hernández L, et al. AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana. Plant J., 2017. 90(3): p. 520-534 [PMID:28207974]