PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462944268 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 101aa MW: 11601.5 Da PI: 10.0043 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.3 | 1.5e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEd++l + ++++G g+W+++++ g+ R++k+c++rw +yl 462944268 14 RGLWSPEEDDKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61 789*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.9E-27 | 8 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.858 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 7.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.76E-22 | 16 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.13E-11 | 17 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.008 | 62 | 86 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 7.6E-9 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MARRATGQKK KLRRGLWSPE EDDKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY 60 LRPDLKRGAF SQEEEDLIIH LHSMLGNKCV PAETSIHAFL N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-16 | 11 | 88 | 24 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 7 | 13 | QKKKLRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462944268 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT034016 | 4e-92 | BT034016.1 Zea mays full-length cDNA clone ZM_BFc0036C19 mRNA, complete cds. | |||
GenBank | BT035399 | 4e-92 | BT035399.1 Zea mays full-length cDNA clone ZM_BFb0059D04 mRNA, complete cds. | |||
GenBank | BT040989 | 4e-92 | BT040989.1 Zea mays full-length cDNA clone ZM_BFc0162L22 mRNA, complete cds. | |||
GenBank | BT067525 | 4e-92 | BT067525.1 Zea mays full-length cDNA clone ZM_BFc0072I17 mRNA, complete cds. | |||
GenBank | KJ727614 | 4e-92 | KJ727614.1 Zea mays clone pUT5525 MYB transcription factor (MYB23) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004958441.1 | 4e-56 | transcription factor MYB61 | ||||
Swissprot | Q8VZQ2 | 7e-46 | MYB61_ARATH; Transcription factor MYB61 | ||||
TrEMBL | Q8S438 | 2e-55 | Q8S438_SORBI; P-type R2R3 Myb protein (Fragment) | ||||
STRING | Sb02g040480.1 | 1e-54 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3092 | 33 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G57560.1 | 4e-49 | myb domain protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|