PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462936314
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 139aa    MW: 15932.1 Da    PI: 11.0473
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462936314genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM31.45.6e-10127102128
        NAM 102 lkktLvfykgrapkgektdWvmheyrl 128
                +kkt+vfy+g+ap+g+kt+W m+eyr+
  462936314   1 MKKTMVFYRGHAPSGTKTTWKMNEYRA 27 
                8************************95 PP

2Myb_DNA-binding26.91.1e-08801161147
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l++++ +++G g+W+ I+r    +Rt+ q+ s+ qky
        462936314  80 LFLQGLEKYGRGDWRNISRFAVRTRTPTQVASHAQKY 116
                      699*********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-10167IPR003441NAC domain
PROSITE profilePS5100515.689169IPR003441NAC domain
CDDcd001677.61E-780117No hitNo description
PfamPF002491.3E-680116IPR001005SANT/Myb domain
SuperFamilySSF466891.63E-1080120IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1180120IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.3E-781121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MKKTMVFYRG HAPSGTKTTW KMNEYRALHY HDASGADGSS SASAHAAAPL NLPPPQLRSE  60
FSLCRLYTTR PFSRCCQRWL FLQGLEKYGR GDWRNISRFA VRTRTPTQVA SHAQKYFNRQ  120
LNPASRDSKR KSIHDITTP
Cis-element ? help Back to Top
SourceLink
PlantRegMap462936314
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0422257e-67BT042225.1 Zea mays full-length cDNA clone ZM_BFb0168P15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456680.13e-35transcription factor DIVARICATA
RefseqXP_025817656.12e-35transcription factor DIVARICATA-like
TrEMBLA0A1E5UTG33e-34A0A1E5UTG3_9POAL; Transcription factor DIVARICATA
TrEMBLA0A3L6SN814e-34A0A3L6SN81_PANMI; Transcription factor DIVARICATA-like
STRINGSb03g040730.11e-34(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-23Homeodomain-like transcriptional regulator