PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462936202 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 214aa MW: 23818 Da PI: 9.3857 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 158 | 4e-49 | 9 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lp+GfrF+Ptdeelv +yLk+k++g +++ i++vd+ +ePwdLp k +k+++ ew+fF++ d+ky+ g+r+nr+t++gyWkatgkd+ + s+ g 462936202 9 LPVGFRFRPTDEELVRHYLKPKIAGLPHPDLLLIPDVDLSACEPWDLPaKaLIKSDDPEWFFFAHLDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRpAG 108 79*************************999889**************95346777888**************************************9899 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 +l+g+kktLvf++grap+g++t W+mheyr 462936202 109 NLIGIKKTLVFHRGRAPRGHRTAWIMHEYRT 139 99***************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.68E-56 | 6 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.291 | 9 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-26 | 10 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MSSPAAAPLP VGFRFRPTDE ELVRHYLKPK IAGLPHPDLL LIPDVDLSAC EPWDLPAKAL 60 IKSDDPEWFF FAHLDRKYPG GHRSNRSTAA GYWKATGKDR LIRSRPAGNL IGIKKTLVFH 120 RGRAPRGHRT AWIMHEYRTT EPHLQQGQHG SFVLYRLFNK NEEEEEAPVG SSNLEDADSP 180 STSAPAISPV VKPPKLARRP LVANDDDPAA PQVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-44 | 9 | 166 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-44 | 9 | 166 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-44 | 9 | 166 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-44 | 9 | 166 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swm_B | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swm_C | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swm_D | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swp_A | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swp_B | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swp_C | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
3swp_D | 5e-44 | 9 | 166 | 20 | 174 | NAC domain-containing protein 19 |
4dul_A | 6e-44 | 9 | 166 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 6e-44 | 9 | 166 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462936202 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025813332.1 | 1e-107 | uncharacterized protein LOC112890695 | ||||
Swissprot | F4JN35 | 2e-63 | NTL9_ARATH; Protein NTM1-like 9 | ||||
TrEMBL | A0A2S3HMK8 | 1e-107 | A0A2S3HMK8_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7E457 | 1e-106 | A0A2T7E457_9POAL; Uncharacterized protein | ||||
STRING | Sb10g000101.1 | 1e-108 | (Sorghum bicolor) | ||||
STRING | GRMZM2G163914_P02 | 1e-105 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13413 | 25 | 29 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35580.3 | 9e-66 | NAC transcription factor-like 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|