PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462935024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 109aa    MW: 12711.6 Da    PI: 10.1883
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462935024genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
        462935024 14 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     789*******************************************97 PP

2Myb_DNA-binding50.93.7e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w+
        462935024  67 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWN 109
                      89********************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24964IPR009057Homeodomain-like
PROSITE profilePS5129424.594965IPR017930Myb domain
SuperFamilySSF466893.11E-3011108IPR009057Homeodomain-like
SMARTSM007176.8E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001671.74E-101761No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2365109IPR009057Homeodomain-like
PROSITE profilePS5129418.76966109IPR017930Myb domain
SMARTSM007173.9E-966109IPR001005SANT/Myb domain
PfamPF002491.1E-1467109IPR001005SANT/Myb domain
CDDcd001674.63E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MGREAAATRP KLRRGLWSPE EDEKLYNHII RYGVGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGSF SQQEEDLIIS LHKILGNRWS QIASQLPGRT DNEIKNFWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291010923121MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462935024
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794211e-135HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457980.15e-78myb-related protein Hv33
SwissprotP200273e-63MYB3_HORVU; Myb-related protein Hv33
TrEMBLC5XMX81e-76C5XMX8_SORBI; Uncharacterized protein
STRINGSb03g024500.12e-77(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-62myb domain protein 86