PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462935024 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 109aa MW: 12711.6 Da PI: 10.1883 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.1 | 7.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+l++ + ++G g+W+++++ g+ R++k+c++rw +yl 462935024 14 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 61 789*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.9 | 3.7e-16 | 67 | 109 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w+ 462935024 67 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWN 109 89********************.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-24 | 9 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.594 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.11E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.8E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.74E-10 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-23 | 65 | 109 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.769 | 66 | 109 | IPR017930 | Myb domain |
SMART | SM00717 | 3.9E-9 | 66 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 67 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.63E-10 | 69 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MGREAAATRP KLRRGLWSPE EDEKLYNHII RYGVGCWSSV PKLAGLERCG KSCRLRWINY 60 LRPDLKRGSF SQQEEDLIIS LHKILGNRWS QIASQLPGRT DNEIKNFWN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-29 | 10 | 109 | 23 | 121 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462935024 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679421 | 1e-135 | HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002457980.1 | 5e-78 | myb-related protein Hv33 | ||||
Swissprot | P20027 | 3e-63 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | C5XMX8 | 1e-76 | C5XMX8_SORBI; Uncharacterized protein | ||||
STRING | Sb03g024500.1 | 2e-77 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11164 | 30 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 1e-62 | myb domain protein 86 |