PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462926063 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 104aa MW: 11866.4 Da PI: 11.9792 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.2 | 5e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l++++++ G g+W+t +r g++R++k+c++rw +yl 462926063 14 KGPWTPEEDEKLLQYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-25 | 5 | 69 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.105 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.99E-19 | 10 | 69 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.43E-11 | 16 | 61 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MGRSPCCDES GLKKGPWTPE EDEKLLQYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY 60 LRPDIKRGNG RRSRRTCRAA RTTRSRTSGT RTSRSGSSRW ASTP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462926063 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728309 | 2e-75 | KJ728309.1 Zea mays clone pUT6589 MYB transcription factor (MYB63) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004973754.1 | 8e-45 | transcription factor MYB41 | ||||
Swissprot | Q9S9Z2 | 2e-41 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | K3YIN4 | 2e-43 | K3YIN4_SETIT; Uncharacterized protein | ||||
STRING | Si014103m | 3e-44 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G02940.1 | 1e-41 | myb domain protein 107 |
Publications ? help Back to Top | |||
---|---|---|---|
|