PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462924105 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 122aa MW: 14433.6 Da PI: 10.7886 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 98.4 | 1e-30 | 5 | 79 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl 462924105 5 GEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 79 789**********************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 33.028 | 1 | 99 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.44E-32 | 3 | 86 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-13 | 9 | 79 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MAAIGEKEWF FYVPRDRKYR NGDRPNRVTA SGYWKATGAD RMIRAENSRP IGLKKTLVFY 60 SGKAPKGVRS SWIMNEYRLP PDDTDRYHKV FLLPTSYFLP WHTVDHTKKR HHTRLLPNPP 120 RC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swm_B | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swm_C | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swm_D | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_A | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_B | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_C | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_D | 3e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462924105 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT033902 | 1e-114 | BT033902.1 Zea mays full-length cDNA clone ZM_BFc0061J19 mRNA, complete cds. | |||
GenBank | BT039864 | 1e-114 | BT039864.1 Zea mays full-length cDNA clone ZM_BFc0047I12 mRNA, complete cds. | |||
GenBank | EU957131 | 1e-114 | EU957131.1 Zea mays clone 1583712 hypothetical protein mRNA, complete cds. | |||
GenBank | KJ728024 | 1e-114 | KJ728024.1 Zea mays clone pUT6160 NAC transcription factor (NAC95) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015695832.1 | 1e-56 | PREDICTED: NAC transcription factor ONAC010 | ||||
Swissprot | Q9ZVP8 | 8e-51 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A1E5WH59 | 2e-56 | A0A1E5WH59_9POAL; NAC domain-containing protein 35 | ||||
STRING | LPERR01G34330.2 | 3e-56 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2826 | 37 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 3e-53 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|