PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462923223 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 111aa MW: 12838.9 Da PI: 10.8103 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.8 | 1.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ede+l+ +vk +G g W+ ++++ g++R++k+c++rw++yl 462923223 14 RGAWTSKEDEILAAYVKAHGEGKWREVPQRAGLRRCGKSCRLRWLNYL 61 89*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.9E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.898 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 2.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.51E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.35E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.356 | 62 | 101 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-7 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MGRKACCAKE GVKRGAWTSK EDEILAAYVK AHGEGKWREV PQRAGLRRCG KSCRLRWLNY 60 LRPNIKRGNI SDDEEDLIIR LHKLLGNRSV RSRAHEQIDP WASKFKLKLV N |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462923223 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025812125.1 | 1e-54 | anthocyanin regulatory C1 protein-like | ||||
Swissprot | P10290 | 7e-54 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A1E5WII7 | 7e-54 | A0A1E5WII7_9POAL; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A368QS51 | 6e-54 | A0A368QS51_SETIT; Uncharacterized protein | ||||
TrEMBL | Q8W0U3 | 2e-53 | Q8W0U3_SORBI; Putative anthocyanin regulatory C1 | ||||
STRING | Pavir.Db02046.1.p | 4e-55 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 5e-42 | myb domain protein 5 |