PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462920544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 412aa    MW: 44768.3 Da    PI: 5.3292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462920544genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.3e-091647132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd +l+ +++++G  +W++ ++  g
        462920544 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAG 47
                     799***********************999988 PP

2Myb_DNA-binding54.42.9e-1766113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
        462920544  66 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 113
                      79********************************************97 PP

3Myb_DNA-binding55.81.1e-17119164148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
        462920544 119 RGNFTAEEEETIIKLHAMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 164
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-11749IPR009057Homeodomain-like
SuperFamilySSF466893.38E-81046IPR009057Homeodomain-like
PROSITE profilePS500907.4221150IPR017877Myb-like domain
SMARTSM007170.121557IPR001005SANT/Myb domain
PfamPF002492.3E-71648IPR001005SANT/Myb domain
CDDcd001672.09E-51848No hitNo description
PROSITE profilePS5129416.97661113IPR017930Myb domain
SuperFamilySSF466892.66E-2965160IPR009057Homeodomain-like
SMARTSM007174.4E-1365115IPR001005SANT/Myb domain
PfamPF002495.8E-1566113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2367120IPR009057Homeodomain-like
CDDcd001674.91E-1168113No hitNo description
PROSITE profilePS5129425.392114168IPR017930Myb domain
SMARTSM007171.6E-15118166IPR001005SANT/Myb domain
PfamPF002495.9E-16119164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-27121167IPR009057Homeodomain-like
CDDcd001674.84E-12121164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGTYR FAAVREELPA  60
AAHTNKGAWT KEEDQRLVAY IKAHGEGCWR SLPKAAGLQR CGKSCRLRWI NYLRPDLKRG  120
NFTAEEEETI IKLHAMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAP RGDDGAAGAR  180
KKKKQKSSSA GAEQEAAVIP SPSLCWFATT TNCSSGDSSG EQQSNATDEL DPRSLDIPTM  240
LDDAGFDFGD MLVDPTAPVP ELYCPSVSVP TSPCVSSTSP PPARGGVDDL LELPEIEIYQ  300
ELWSIIDGDG GSFAEAPPAA PCHGNATGAD AATTSQEEGK EWWLENLERE LGLWGPMEDY  360
QNPMGPLGPI AHPDSLPAMV QDPVSCYFQP GPNPTTFQGQ PEHSAVLTSN RI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-28141684159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-28141684159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164183KKRVAPRGDDGAAGARKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMap462920544
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119602e-81AK111960.1 Oryza sativa Japonica Group cDNA clone:001-031-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824709.11e-146myb-related protein Zm1-like
TrEMBLA0A2S3I9V41e-145A0A2S3I9V4_9POAL; Uncharacterized protein
STRINGPavir.Ga00752.1.p1e-141(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-65myb domain protein 4