PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462917732 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 171aa MW: 19328.3 Da PI: 10.2354 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.2 | 3.2e-53 | 11 | 140 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lppGfrFhP+d+elv +yL +k++gk e + + +vd++k+ePw+Lp+++ + +ewyfFs +d+kyatg+r+nrat+sgyWkatgkd++v+++ ++ 462917732 11 LPPGFRFHPRDDELVLDYLGRKLSGKGGEYGGIaMVDVDLNKCEPWELPEAACVGGREWYFFSLHDRKYATGQRTNRATRSGYWKATGKDRPVFRRrGEG 110 79*************************877666699*************7666789**************************************996667 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +vg++ktLvfy+grap+g+kt+Wvmhe+r+ 462917732 111 VVGMRKTLVFYQGRAPRGSKTEWVMHEFRV 140 8***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.03E-54 | 3 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 50.582 | 11 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-26 | 12 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MSLISMMEAR LPPGFRFHPR DDELVLDYLG RKLSGKGGEY GGIAMVDVDL NKCEPWELPE 60 AACVGGREWY FFSLHDRKYA TGQRTNRATR SGYWKATGKD RPVFRRRGEG VVGMRKTLVF 120 YQGRAPRGSK TEWVMHEFRV EGHPPVADAV VAARPGSPLK VRYVLAAPRC L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-45 | 8 | 140 | 12 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462917732 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU963031 | 1e-136 | EU963031.1 Zea mays clone 247548 NAC domain-containing protein 21/22 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025824710.1 | 1e-84 | NAC domain-containing protein 21/22-like | ||||
Swissprot | Q84TE6 | 4e-66 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A2S3IAF0 | 3e-83 | A0A2S3IAF0_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6Q6J0 | 4e-85 | A0A3L6Q6J0_PANMI; NAC domain-containing protein 21/22-like | ||||
STRING | Pavir.Gb00488.1.p | 4e-85 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1012 | 37 | 138 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56010.2 | 3e-67 | NAC domain containing protein 1 |