PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462917328

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

HSF

Protein Properties

Length: 87aa MW: 10067.4 Da PI: 4.9776

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462917328	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	81.1	1.7e-25	28	86	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+ +++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y 462917328 28 FLTKTYQLVDDPCTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY 86 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.6E-27	20	86	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.1E-19	24	87	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	4.49E-23	27	86	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	1.5E-21	28	86	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.6E-16	28	51	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.6E-16	66	78	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.6E-16	79	87	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MAFLVERCGE MVVSMESSPH AKPVPAPFLT KTYQLVDDPC TDHIVSWGED DTTFVVWRPP 60 EFARDLLPNY FKHNNFSSFV RQLNTYV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ldu_A	2e-16	24	86	17	78	Heat shock factor protein 1
5d5u_B	2e-16	24	86	26	87	Heat shock factor protein 1
5d5v_B	2e-16	24	86	26	87	Heat shock factor protein 1
5d5v_D	2e-16	24	86	26	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462917328

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT054148	1e-104	BT054148.1 Zea mays full-length cDNA clone ZM_BFb0133K13 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025804091.1	2e-58	heat stress transcription factor B-4b-like
Swissprot	Q7XHZ0	4e-55	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	A0A1E5VCU8	4e-57	A0A1E5VCU8_9POAL; Heat stress transcription factor B-4b
TrEMBL	A0A2S3H4D8	5e-57	A0A2S3H4D8_9POAL; Uncharacterized protein
TrEMBL	A0A2T7EZ90	4e-57	A0A2T7EZ90_9POAL; Uncharacterized protein
TrEMBL	A0A3L6QPD0	5e-57	A0A3L6QPD0_PANMI; Heat stress transcription factor B-4b-like
STRING	Pavir.J32257.1.p	8e-57	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP121	37	394

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	7e-42	heat shock transcription factor B4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]