PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462916576 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 72aa MW: 8203.21 Da PI: 4.4119 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 46.9 | 9.1e-15 | 17 | 70 | 1 | 55 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaee 55 l pGf FhP+dee++ +yL++kv++ ++++ +i e+di+++ePw+Lp k+k +e 462916576 17 LKPGFCFHPSDEEIIPCYLTPKVHDYNFTA-VTIGEADINTSEPWELPCKAKMGE 70 579************************999.66***************6655554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.66E-16 | 14 | 72 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 17.058 | 17 | 72 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-5 | 19 | 60 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MEDNHQLQQG AERPLNLKPG FCFHPSDEEI IPCYLTPKVH DYNFTAVTIG EADINTSEPW 60 ELPCKAKMGE KE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462916576 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022989901.1 | 4e-23 | NAC domain-containing protein 92-like | ||||
Swissprot | Q9FK44 | 7e-22 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
TrEMBL | A0A1J7HLV1 | 4e-21 | A0A1J7HLV1_LUPAN; Uncharacterized protein | ||||
TrEMBL | A0A444ZP69 | 1e-21 | A0A444ZP69_ARAHY; Uncharacterized protein | ||||
STRING | Lus10026879 | 4e-23 | (Linum usitatissimum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.2 | 7e-25 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|