PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462916219 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 215aa MW: 24620.9 Da PI: 9.1693 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 170.3 | 6.1e-53 | 10 | 139 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 +ppGfrFhPtdeel+ +yLkkk+ ++++l evikevd++k+ePw+L++ ++ + ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + + 462916219 10 VPPGFRFHPTDEELLLYYLKKKIGFERFDL-EVIKEVDLNKIEPWELQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKCIRT-SY 107 69****************************.99**************963433332566*************************************9.89 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrle 129 +++g++ktLvfy+grap+g+kt+W+mheyrle 462916219 108 RKIGMRKTLVFYRGRAPHGQKTEWIMHEYRLE 139 99****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.27E-57 | 5 | 148 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.516 | 10 | 190 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.5E-28 | 11 | 138 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.27E-57 | 178 | 190 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048829 | Biological Process | root cap development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MAAFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFERFDLE VIKEVDLNKI EPWELQERCR 60 IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR 120 GRAPHGQKTE WIMHEYRLEE ADDAQGGTSV RLLAFSSHAS EILSIHRADD RWCVPDVQED 180 GWVVCRVFKK KCFFKIGGGE GSTSQGADGA GVHMA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-50 | 10 | 191 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-50 | 10 | 191 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-50 | 10 | 191 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-50 | 10 | 191 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 1e-50 | 10 | 191 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 1e-50 | 10 | 191 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 1e-50 | 10 | 191 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00431 | DAP | Transfer from AT4G10350 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462916219 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU971542 | 0.0 | EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025824150.1 | 1e-126 | protein BEARSKIN1-like | ||||
Swissprot | Q9SV87 | 1e-97 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | A0A2T7CVD3 | 1e-127 | A0A2T7CVD3_9POAL; Uncharacterized protein | ||||
STRING | Sb06g017720.1 | 1e-124 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9297 | 30 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 8e-86 | NAC domain containing protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|