PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462913881 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 177aa MW: 19080.4 Da PI: 10.0989 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 136.9 | 1.3e-42 | 24 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l+++g 462913881 24 LPPGFRFHPTDEELVVHYLKKKAASLPLPV-TIIAEVDLYKFDPWELPEKASFGEHEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASGG--- 119 79****************************.89***************9999999***************************************544... PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 r+pkg kt+W+mheyrl 462913881 120 ----------SRDPKGLKTNWIMHEYRL 137 ..........489*************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.68E-53 | 20 | 143 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 38.915 | 24 | 177 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-22 | 25 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MESTDSSSGS APPQQKPPGP APHLPPGFRF HPTDEELVVH YLKKKAASLP LPVTIIAEVD 60 LYKFDPWELP EKASFGEHEW YFFSPRDRKY PNGARPNRAA TSGYWKATGT DKPILASGGS 120 RDPKGLKTNW IMHEYRLTDA ASSANTSRPP PPGAGAGGGG GSSKAAASLR VRNVRTT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swm_B | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swm_C | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swm_D | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swp_A | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swp_B | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swp_C | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
3swp_D | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
4dul_A | 7e-57 | 14 | 139 | 7 | 144 | NAC domain-containing protein 19 |
4dul_B | 7e-57 | 14 | 139 | 7 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462913881 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT085989 | 1e-113 | BT085989.1 Zea mays full-length cDNA clone ZM_BFc0095M07 mRNA, complete cds. | |||
GenBank | BT086467 | 1e-113 | BT086467.1 Zea mays full-length cDNA clone ZM_BFc0169O24 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002463039.1 | 1e-88 | NAC transcription factor NAM-B2 | ||||
Swissprot | A2YMR0 | 3e-89 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
Swissprot | Q8H4S4 | 4e-89 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
TrEMBL | A0A0E0ALI9 | 3e-87 | A0A0E0ALI9_9ORYZ; Uncharacterized protein | ||||
TrEMBL | C5XBN1 | 3e-87 | C5XBN1_SORBI; Uncharacterized protein | ||||
STRING | OGLUM07G18780.1 | 5e-88 | (Oryza glumipatula) | ||||
STRING | Sb02g036620.1 | 5e-88 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7572 | 36 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 4e-69 | NAC domain containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|